DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IFT20 and Ift20

DIOPT Version :9

Sequence 1:NP_724409.3 Gene:IFT20 / 246616 FlyBaseID:FBgn0050441 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001099285.1 Gene:Ift20 / 287541 RGDID:1309400 Length:157 Species:Rattus norvegicus


Alignment Length:123 Identity:41/123 - (33%)
Similarity:71/123 - (57%) Gaps:0/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LQKVGVFIDEIYTVRVEHPNLSSSKIMFKQECFNYIKAFTIFKKFVFNYCNISETFAKDVDKEKL 68
            |.:.|:..||:..:||..|.::......|:||.:::.....|:|.|.....:.:..||:.:.||:
  Rat    31 LGEAGLHFDELNKLRVLDPEVTQQTTELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKM 95

  Fly    69 RAIGTQNQLKTAFIQRQNKQQVYQYEIFEQTVELERLKGELQFLQRIETEQHEIINNF 126
            :|||.:|.||:...||:.:||..|..|.|:.::|||.:.|.:.|.::|.||:|.|:.|
  Rat    96 KAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQF 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IFT20NP_724409.3 IFT20 8..126 CDD:291592 39/117 (33%)
Ift20NP_001099285.1 IFT20 36..144 CDD:405600 33/107 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341630
Domainoid 1 1.000 77 1.000 Domainoid score I8685
eggNOG 1 0.900 - - E1_2AFZ8
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H49559
Inparanoid 1 1.050 79 1.000 Inparanoid score I5128
OMA 1 1.010 - - QHG56504
OrthoDB 1 1.010 - - D1589590at2759
OrthoFinder 1 1.000 - - FOG0007025
OrthoInspector 1 1.000 - - oto96057
orthoMCL 1 0.900 - - OOG6_104950
Panther 1 1.100 - - LDO PTHR31978
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.