DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IFT20 and ift-20

DIOPT Version :9

Sequence 1:NP_724409.3 Gene:IFT20 / 246616 FlyBaseID:FBgn0050441 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_740843.1 Gene:ift-20 / 260266 WormBaseID:WBGene00022465 Length:129 Species:Caenorhabditis elegans


Alignment Length:122 Identity:35/122 - (28%)
Similarity:62/122 - (50%) Gaps:2/122 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EELQKVGVFIDEIYTVRVEHPNLSSSKIMFKQECFNYIKAFTIFKKFVFNYCNISETFAKDVDKE 66
            |:|.|.|:|:|:...:|:..|:::......:.:...:......|:.......:..|.||..|:.|
 Worm     4 EQLAKAGLFVDDFNRLRLIDPDVAELLQSAQDKSSEFNDQLKNFQTTTGGLIDSIEEFANVVETE 68

  Fly    67 KLRAIGTQNQLKTAFIQRQNKQQVYQYEIFEQTVELERLKGELQFLQRIETEQHEII 123
            |:||:..:|..:...  .::...:.|..|.|.|||.|||:.||:.:::||.||.|.|
 Worm    69 KIRAMMVRNTQERDL--AEDDPVLLQMTIRELTVEKERLRVELEAVRKIEKEQDECI 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IFT20NP_724409.3 IFT20 8..126 CDD:291592 32/116 (28%)
ift-20NP_740843.1 IFT20 10..126 CDD:317355 32/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159737
Domainoid 1 1.000 45 1.000 Domainoid score I8265
eggNOG 1 0.900 - - E1_2AFZ8
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I4101
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56504
OrthoDB 1 1.010 - - D1589590at2759
OrthoFinder 1 1.000 - - FOG0007025
OrthoInspector 1 1.000 - - oto17662
orthoMCL 1 0.900 - - OOG6_104950
Panther 1 1.100 - - LDO PTHR31978
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4108
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.800

Return to query results.
Submit another query.