DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and UGT76E2

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_200767.1 Gene:UGT76E2 / 836078 AraportID:AT5G59590 Length:449 Species:Arabidopsis thaliana


Alignment Length:441 Identity:78/441 - (17%)
Similarity:147/441 - (33%) Gaps:154/441 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KSHKIPFWELAKGLISRGHNITFLSGFPADFNIEGLLEVTPAGLVEYIHNYTNWDLLGSRMAGEM 94
            :.|..|..:|.|.|.|:|.:||.:              :|.:..|....::::            
plant    19 QGHVTPMMQLGKALHSKGFSITVV--------------LTQSNRVSSSKDFSD------------ 57

  Fly    95 PIKPWDGLRYAFESCDAMLRDSETKELTKKSFDL---AILDGAFPECFLGLMY------------ 144
                     :.|.:....|.:|:.:.|..:.|.|   .|.:.:|.:|...|::            
plant    58 ---------FHFLTIPGSLTESDLQNLGPQKFVLKLNQICEASFKQCIGQLLHEQCNNDIACVVY 113

  Fly   145 ------------DFKIPFMYINT---VGFYTGSISTAGNPVSYAIT-----------PNFYS-RF 182
                        :|::|.:..:|   ..|...|:.:..|..|:.|.           |..:. |:
plant   114 DEYMYFSHAAVKEFQLPSVVFSTTSATAFVCRSVLSRVNAESFLIDMKDPETQDKVFPGLHPLRY 178

  Fly   183 TD-----------TMNLYERAINTAMQIGQTLMHMYVMRRTHLV-MREHLGTQIPHPYEMSRNVS 235
            .|           |:.:|...:||.......:.....:..:.|. :::.|  |:|          
plant   179 KDLPTSVFGPIESTLKVYSETVNTRTASAVIINSASCLESSSLARLQQQL--QVP---------- 231

  Fly   236 FILQNGHAVLSYPRAFNPNVAEVACIH---CRPARKL--PRNLEEFIGASGASGFIYVSMGSSVK 295
                      .||         :..:|   ..|:..|  .|:..|::....::..||:|:||   
plant   232 ----------VYP---------IGPLHITASAPSSLLEEDRSCVEWLNKQKSNSVIYISLGS--- 274

  Fly   296 AANMPEALRHMLVKTFARLPYHV-------LWKYEGSSTDIKDITSNVK------------LSRW 341
                   |..|..|....:.:.:       ||.....|....:.|.::.            :.:|
plant   275 -------LALMDTKDMLEMAWGLSNSNQPFLWVVRPGSIPGSEWTESLPEEFNRLVSERGYIVKW 332

  Fly   342 LPQQDILGHPKLRAFVTHGGLLSMFETVYHGVPVVTMPVFCDHDVNSAKAE 392
            .||.::|.||.:..|.:|.|..|..|::..|||::..|...|..||:...|
plant   333 APQMEVLRHPAVGGFWSHCGWNSTVESIGEGVPMICRPFTGDQKVNARYLE 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 78/441 (18%)
egt <172..479 CDD:223071 50/269 (19%)
UGT76E2NP_200767.1 Glycosyltransferase_GTB-type 1..449 CDD:415824 78/441 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.