DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and UF3GT

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_200217.1 Gene:UF3GT / 835489 AraportID:AT5G54060 Length:468 Species:Arabidopsis thaliana


Alignment Length:471 Identity:79/471 - (16%)
Similarity:147/471 - (31%) Gaps:154/471 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HKIPFWELAKGLISRGHNITFLSGFPADFNIEGLLEVTPAGLVEYIHNY---------------- 80
            |..||..|:..|..:||.|.||  .|.    :.|.::.|..|...:..:                
plant    24 HMTPFLHLSNKLAEKGHKIVFL--LPK----KALNQLEPLNLYPNLITFHTISIPQVKGLPPGAE 82

  Fly    81 TNWD-------LLGSRMAGEMP--------IKPWDGLRYAFESCDAMLRDSE--TKELTKKSFDL 128
            ||.|       ||...|....|        |||           |.:..||.  ..|:.|..   
plant    83 TNSDVPFFLTHLLAVAMDQTRPEVETIFRTIKP-----------DLVFYDSAHWIPEIAKPI--- 133

  Fly   129 AILDGAFPECFLGLMYDFKIPFMYINTVGFYTGSISTAGNPVSYAITPNFYSRFTDTMNLYERAI 193
                ||...||                      :|.:|.: ::.::.|:......|...:     
plant   134 ----GAKTVCF----------------------NIVSAAS-IALSLVPSAEREVIDGKEM----- 166

  Fly   194 NTAMQIGQTLMHMYVMRRTHLVMREHLGTQIPHPYEMSRNVSFILQNGHAVLSYPRAFNPNVA-- 256
             :..::.:|.:.   ...:.:|:|.|          .::::||:.:...|:.|:   |:..|.  
plant   167 -SGEELAKTPLG---YPSSKVVLRPH----------EAKSLSFVWRKHEAIGSF---FDGKVTAM 214

  Fly   257 ----EVACIHCRPAR------------------------------KLPRNLEEFIGASGASGFIY 287
                .:|...||...                              .|.....|::........::
plant   215 RNCDAIAIRTCRETEGKFCDYISRQYSKPVYLTGPVLPGSQPNQPSLDPQWAEWLAKFNHGSVVF 279

  Fly   288 VSMGSSVKAANMPEALRHMLVKTFARLPYHVLWKYEGSSTDIKDIT----------SNVKLSRWL 342
            .:.||......:.:.....|.......|:.|..|.....:.:::..          ..|....|:
plant   280 CAFGSQPVVNKIDQFQELCLGLESTGFPFLVAIKPPSGVSTVEEALPEGFKERVQGRGVVFGGWI 344

  Fly   343 PQQDILGHPKLRAFVTHGGLLSMFETVYHGVPVVTMPVFCDHDVNSAKAEVDGYAIKLDLQT--- 404
            .|..:|.||.:..||:|.|..||:|::.....:|.:|...:..:| |:...:...:.::::.   
plant   345 QQPLVLNHPSVGCFVSHCGFGSMWESLMSDCQIVLVPQHGEQILN-ARLMTEEMEVAVEVEREKK 408

  Fly   405 --LSANQLYKAIMKVI 418
              .|...|..|:..|:
plant   409 GWFSRQSLENAVKSVM 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 79/471 (17%)
egt <172..479 CDD:223071 44/298 (15%)
UF3GTNP_200217.1 Glycosyltransferase_GTB-type 10..462 CDD:415824 79/471 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I2411
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.