powered by:
Protein Alignment Ugt50B3 and AT5G17040
DIOPT Version :9
Sequence 1: | NP_001260710.1 |
Gene: | Ugt50B3 / 246614 |
FlyBaseID: | FBgn0050438 |
Length: | 524 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_197206.2 |
Gene: | AT5G17040 / 831567 |
AraportID: | AT5G17040 |
Length: | 442 |
Species: | Arabidopsis thaliana |
Alignment Length: | 76 |
Identity: | 26/76 - (34%) |
Similarity: | 38/76 - (50%) |
Gaps: | 15/76 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 341 WLPQQDILGHPKLRAFVTHGGLLSMFETVYHGVPVVTMPVFCDHDVNSAKAEV------------ 393
|.||.::|.|..:..||:|||..|:.|:|..|||::..|:|.||.:|:...|.
plant 321 WAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHALNARSVEAVWEIGMTISSGV 385
Fly 394 ---DGYAIKLD 401
||:...||
plant 386 FTKDGFEESLD 396
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
76 |
1.000 |
Domainoid score |
I3136 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X13 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.