DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and AT4G09500

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_974524.1 Gene:AT4G09500 / 826534 AraportID:AT4G09500 Length:442 Species:Arabidopsis thaliana


Alignment Length:409 Identity:88/409 - (21%)
Similarity:145/409 - (35%) Gaps:122/409 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HKIPFWELAKGLISRGHNITFLSGFPADFNIEGLLEVTPAGLVEYIHNYT----NWDLLGSRMAG 92
            |.|||..||..|..:||.:|||....|...:|. ..:.|..:|  .|..|    |....|:....
plant    17 HMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEH-HNLFPDSIV--FHPLTVPPVNGLPAGAETTS 78

  Fly    93 EMPIKPWDGLRYAFESCDAMLRDSETKELTKKSFDLAILDGAFPECFLGLMYDFK--IPFM---- 151
            ::||           |.|.:|  |:..:||:...:.|: ....|:.   :.:||.  ||.|    
plant    79 DIPI-----------SLDNLL--SKALDLTRDQVEAAV-RALRPDL---IFFDFAQWIPDMAKEH 126

  Fly   152 YINTVGFYTGSISTAGN-----------PVSY---------------AITPNFYSRFTDTMNLYE 190
            .|.:|.:...|.:|..:           |..|               |....||.|      ||.
plant   127 MIKSVSYIIVSATTIAHTHVPGGKLGVRPPGYPSSKVMFRENDVHALATLSIFYKR------LYH 185

  Fly   191 R-----------AINTAMQIGQTLMHMYVMRRTHLVMREHL--GTQIPHPYEMSRNVSFILQNGH 242
            :           |:.|..:: :.:...::.|:.|   ::.|  |...|.| :.|:.:.   :..:
plant   186 QITTGLKSCDVIALRTCKEV-EGMFCDFISRQYH---KKVLLTGPMFPEP-DTSKPLE---ERWN 242

  Fly   243 AVLSYPRAFNPNVAEVACIHCRPARKLPRNLEEF------IGASGASGFIYVS--MGSSVKAANM 299
            ..||   .|.|.    :.:.|.|..::....::|      :..:|....:.|.  .|||.....:
plant   243 HFLS---GFAPK----SVVFCSPGSQVILEKDQFQELCLGMELTGLPFLLAVKPPRGSSTVQEGL 300

  Fly   300 PEALRHMLVKTFARLPYHVLWKYEGSSTDIKDITSNVKLSRWLPQQDILGHPKLRAFVTHGGLLS 364
            |                      ||....:||  ..|....|:.|..||.||.:..||.|.|..:
plant   301 P----------------------EGFEERVKD--RGVVWGGWVQQPLILAHPSIGCFVNHCGPGT 341

  Fly   365 MFETVYHGVPVVTMPVFCD 383
            ::|::.....:|.:|...|
plant   342 IWESLVSDCQMVLIPFLSD 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 88/409 (22%)
egt <172..479 CDD:223071 48/248 (19%)
AT4G09500NP_974524.1 PLN02208 1..442 CDD:177858 88/409 (22%)
MGT 8..403 CDD:273616 88/409 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I2411
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.