DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and UGT84A2

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_188793.1 Gene:UGT84A2 / 821710 AraportID:AT3G21560 Length:496 Species:Arabidopsis thaliana


Alignment Length:509 Identity:97/509 - (19%)
Similarity:168/509 - (33%) Gaps:168/509 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KSHKIPFWELAKGLISRGHNITFLS------------------------GF-PADFNIEGLLEVT 69
            :.|..|...|.|.|.|:|..|||::                        |: ..||..:||.|..
plant    21 QGHVNPLLRLGKLLASKGLLITFVTTESWGKKMRISNKIQDRVLKPVGKGYLRYDFFDDGLPEDD 85

  Fly    70 PAGLVEYIHNYTNWDLLGSRMAGEMPIKPWDGLRYAFESCDAMLRDSETKELTKKSFDLAILDGA 134
            .|..........:.:|:|.|....: :|     ||              ||:||:.. ..:::..
plant    86 EASRTNLTILRPHLELVGKREIKNL-VK-----RY--------------KEVTKQPV-TCLINNP 129

  Fly   135 FPECFLGLMYDFKIP----------------FMYINTVGFYTGS-----ISTAGNP-VSYAITPN 177
            |......:..|.:||                :.:.|.|.|.|.:     :..:|.| :.:...|:
plant   130 FVSWVCDVAEDLQIPCAVLWVQSCACLAAYYYYHHNLVDFPTKTEPEIDVQISGMPLLKHDEIPS 194

  Fly   178 F------------------------YSRFTDTMNLYERAINTAMQIGQTLMHMYVMRRTHLVMRE 218
            |                        :|.|.||.|..|:.|         :.||..:....::  .
plant   195 FIHPSSPHSALREVIIDQIKRLHKTFSIFIDTFNSLEKDI---------IDHMSTLSLPGVI--R 248

  Fly   219 HLGTQIPHPYEMSRNVSFILQNGHAVLSYPRAFNPNVAEVA--CIHCRPARKLPRNLEEFIGASG 281
            .||..    |:|::.|::            .....|::|..  |:             |::.:..
plant   249 PLGPL----YKMAKTVAY------------DVVKVNISEPTDPCM-------------EWLDSQP 284

  Fly   282 ASGFIYVSMGSSVKAANMPEALRHMLVKTFARLPYHV-------LWKYEGSSTDI--------KD 331
            .|..:|:|.|:          :.::..:....:.|.|       ||.........        ::
plant   285 VSSVVYISFGT----------VAYLKQEQIDEIAYGVLNADVTFLWVIRQQELGFNKEKHVLPEE 339

  Fly   332 ITSNVKLSRWLPQQDILGHPKLRAFVTHGGLLSMFETVYHGVPVVTMPVFCDHDVNSAKAEVDGY 396
            :....|:..|..|:.:|.||.:..||||.|..|..|.|..|||.|..|.:.| .|..|...:|.:
plant   340 VKGKGKIVEWCSQEKVLSHPSVACFVTHCGWNSTMEAVSSGVPTVCFPQWGD-QVTDAVYMIDVW 403

  Fly   397 AIKLDLQTLSANQLYKAIMKVIHNPRYRNSARHRQKLFLDQRSTALDTAIYWTE 450
            ...:.|....|.:      :::  ||...:.|.|:....::.......|:.|.|
plant   404 KTGVRLSRGEAEE------RLV--PREEVAERLREVTKGEKAIELKKNALKWKE 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 94/491 (19%)
egt <172..479 CDD:223071 60/320 (19%)
UGT84A2NP_188793.1 Glycosyltransferase_GTB-type 1..485 CDD:415824 97/509 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.