DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and UGT76B1

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_187742.1 Gene:UGT76B1 / 820307 AraportID:AT3G11340 Length:447 Species:Arabidopsis thaliana


Alignment Length:467 Identity:90/467 - (19%)
Similarity:152/467 - (32%) Gaps:167/467 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KSHKIPFWELAKGLISRGHNITFL---------SGFPADFNIEGLLEVTPAGL---------VEY 76
            :.|..|.::||....:||.:||.:         |.|| .|....:    |..|         :|.
plant    18 QGHLNPMFQLANIFFNRGFSITVIHTEFNSPNSSNFP-HFTFVSI----PDSLSEPESYPDVIEI 77

  Fly    77 IHNYTN------WDLLGSRMAGEMPIKPW---DGLRYAFESCDAMLRDSETKELTKK-SFDLAIL 131
            :|:..:      .|.| .::..|.|....   |.|.|.            |.:||:| :|...:|
plant    78 LHDLNSKCVAPFGDCL-KKLISEEPTAACVIVDALWYF------------THDLTEKFNFPRIVL 129

  Fly   132 DGAFPECFLGLMYDFKIPFMYINTVGFYTGSISTAGNPVSYAITPNF-YSRFTDT--MNLYERAI 193
            .......|:...     .|..:...|:.:...:.|.:||     |.. |.|..|.  ....:...
plant   130 RTVNLSAFVAFS-----KFHVLREKGYLSLQETKADSPV-----PELPYLRMKDLPWFQTEDPRS 184

  Fly   194 NTAMQIGQTLMHMYVMR----------------RTHLVMREHLGTQIP-------HPYEMSRNVS 235
            ...:|||       ||:                .|..:....:...:|       |.| :|.:.|
plant   185 GDKLQIG-------VMKSLKSSSGIIFNAIEDLETDQLDEARIEFPVPLFCIGPFHRY-VSASSS 241

  Fly   236 FILQNGHAVLSYPRAFNPNVAEVACIHCRPARKLPRNLEEFIGASGASGFIYVSMGS-------- 292
            .:|.:....||:                             :.....:..||.|:||        
plant   242 SLLAHDMTCLSW-----------------------------LDKQATNSVIYASLGSIASIDESE 277

  Fly   293 ------SVKAANMP------EALRH------MLVKTFARLPYHVLWKYEGSSTDIKDITSNVKLS 339
                  .::.:|.|      ..|.|      :|.|.|                 |:::....|:.
plant   278 FLEIAWGLRNSNQPFLWVVRPGLIHGKEWIEILPKGF-----------------IENLEGRGKIV 325

  Fly   340 RWLPQQDILGHPKLRAFVTHGGLLSMFETVYHGVPVVTMPVFCDHDVNSAKAEVDGYAIKLDLQT 404
            :|.||.::|.|.....|:||.|..|..|.:...:|::..|.|.|..|| |:...|.:.|.|.|: 
plant   326 KWAPQPEVLAHRATGGFLTHCGWNSTLEGICEAIPMICRPSFGDQRVN-ARYINDVWKIGLHLE- 388

  Fly   405 LSANQLYKAIMK 416
               |::.:.:::
plant   389 ---NKVERLVIE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 90/467 (19%)
egt <172..479 CDD:223071 55/297 (19%)
UGT76B1NP_187742.1 Glycosyltransferase_GTB-type 1..444 CDD:415824 90/467 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.