DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and DOGT1

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_181218.1 Gene:DOGT1 / 818252 AraportID:AT2G36800 Length:495 Species:Arabidopsis thaliana


Alignment Length:471 Identity:88/471 - (18%)
Similarity:150/471 - (31%) Gaps:173/471 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KSHKIPFWELAKGLISRGHNITFL------------------SGFPADFNIEGLLEVTPAGLVEY 76
            :.|.||..::|:.|..||..||.:                  ||.|.:. ::.......|||.|.
plant    21 QGHMIPMVDIARLLAQRGVIITIVTTPHNAARFKNVLNRAIESGLPINL-VQVKFPYLEAGLQEG 84

  Fly    77 IHNYTNWDLLGSRMAGEMPIKPWDGLRYAFESCDAMLRDSETKELTKKSFDLAILDGAFPECFLG 141
            ..|..:.|.:      |..|..:..:.:..|....::.:...:                |.|   
plant    85 QENIDSLDTM------ERMIPFFKAVNFLEEPVQKLIEEMNPR----------------PSC--- 124

  Fly   142 LMYDFKIPFMYINTVGFYTGSISTAGNPVSYAITPNFYSRFTDTMNLYERAINTAMQIGQTLMH- 205
            |:.||.:|         ||..|:...|                              |.:.|.| 
plant   125 LISDFCLP---------YTSKIAKKFN------------------------------IPKILFHG 150

  Fly   206 --------MYVMRRTHLVMR------------------EHLGTQIP-HPY--------------E 229
                    |:|:|:...::.                  |...||:| ..|              |
plant   151 MGCFCLLCMHVLRKNREILDNLKSDKELFTVPDFPDRVEFTRTQVPVETYVPAGDWKDIFDGMVE 215

  Fly   230 MSRNVSFILQNGHAVL--SYPRAFNP-------NVAEVACIHCRPARKLPRNLE---------EF 276
            .:.....::.|....|  :|.:.:..       .:..|:..:...|.|..|..:         ::
plant   216 ANETSYGVIVNSFQELEPAYAKDYKEVRSGKAWTIGPVSLCNKVGADKAERGNKSDIDQDECLKW 280

  Fly   277 IGASGASGFIYVSMGSSVKAANMP------------EALRHML--VKTFARLPYHVLWKYEGSST 327
            :.:......:||.:||   ..|:|            |:.|..:  ::.:.:....|.|..|....
plant   281 LDSKKHGSVLYVCLGS---ICNLPLSQLKELGLGLEESQRPFIWVIRGWEKYKELVEWFSESGFE 342

  Fly   328 D-IKDITSNVKLSRWLPQQDILGHPKLRAFVTHGGLLSMFETVYHGVPVVTMPVFCDHDVNSAKA 391
            | |:|  ..:.:..|.||..||.||.:..|:||.|..|..|.:..|:|::|.|:|.|...|.   
plant   343 DRIQD--RGLLIKGWSPQMLILSHPSVGGFLTHCGWNSTLEGITAGLPLLTWPLFADQFCNE--- 402

  Fly   392 EVDGYAIKLDLQTLSA 407
                   ||.::.|.|
plant   403 -------KLVVEVLKA 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 88/471 (19%)
egt <172..479 CDD:223071 57/311 (18%)
DOGT1NP_181218.1 Glycosyltransferase_GTB-type 6..491 CDD:415824 88/471 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.