DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and AT2G22930

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_179877.1 Gene:AT2G22930 / 816824 AraportID:AT2G22930 Length:442 Species:Arabidopsis thaliana


Alignment Length:453 Identity:93/453 - (20%)
Similarity:152/453 - (33%) Gaps:136/453 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HKIPFWELAKGLISRGHNITFLSGFPADFNIEGLLEVTPAGLVEYIHNYT----NWDLLGSRMAG 92
            |.|||..||..|..:||.||||....|...:|. ..:.|..:|  .|..|    |....|:....
plant    17 HMIPFLHLANKLAEKGHQITFLLPKKAQKQLEH-HNLFPDSIV--FHPLTIPHVNGLPAGAETTS 78

  Fly    93 EMPIKPWDGLRYAFESCDAMLRDSETKELTKKSFDLAILDGAFPECFLGLMYDFK--IPFM---- 151
            ::.|           |.|.:|  ||..:||:...:.|: ....|:.   :.:||.  ||.:    
plant    79 DISI-----------SMDNLL--SEALDLTRDQVEAAV-RALRPDL---IFFDFAHWIPEIAKEH 126

  Fly   152 YINTVGFYTGSISTAGNPVSYAITPN------------------------------FYSRFTDTM 186
            .|.:|.:...|.:|    ::|...|.                              ||.|     
plant   127 MIKSVSYMIVSATT----IAYTFAPGGVLGVPPPGYPSSKVLYRENDAHALATLSIFYKR----- 182

  Fly   187 NLYER-----------AINTAMQIGQTLMHMYVMRRTHLVMREHL--GTQIPHPYEMSRNVSFIL 238
             ||.:           |:.|..:|...... |:..:.|   ::.|  |..:|   |...:.....
plant   183 -LYHQITTGFKSCDIIALRTCNEIEGKFCD-YISSQYH---KKVLLTGPMLP---EQDTSKPLEE 239

  Fly   239 QNGHAVLSYPRAFNPNVAEVACIHCRPARKLPRNLEEF------IGASGASGFIYVS--MGSSVK 295
            |..|.:..:|    |.    :.:.|....::....::|      :..:|....|.|.  .|||..
plant   240 QLSHFLSRFP----PR----SVVFCALGSQIVLEKDQFQELCLGMELTGLPFLIAVKPPRGSSTV 296

  Fly   296 AANMPEALRHMLVKTFARLPYHVLWKYEGSSTDIKDITSNVKLSRWLPQQDILGHPKLRAFVTHG 360
            ...:||..:.. ||...     |:|                  ..|:.|..||.||.:..||.|.
plant   297 EEGLPEGFQER-VKGRG-----VVW------------------GGWVQQPLILDHPSIGCFVNHC 337

  Fly   361 GLLSMFETVYHGVPVVTMPVFCDHDVNSAKAEVDGYAIKLDLQT-----LSANQLYKAIMKVI 418
            |..:::|.:.....:|.:| |....|...:...:.:.:.:::..     .|...|..||..|:
plant   338 GPGTIWECLMTDCQMVLLP-FLGDQVLFTRLMTEEFKVSVEVSREKTGWFSKESLSDAIKSVM 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 93/453 (21%)
egt <172..479 CDD:223071 54/303 (18%)
AT2G22930NP_179877.1 Glycosyltransferase_GTB_type 1..442 CDD:299143 93/453 (21%)
MGT 8..403 CDD:273616 93/453 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I2411
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.