DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and UGT2A3

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_011530549.1 Gene:UGT2A3 / 79799 HGNCID:28528 Length:533 Species:Homo sapiens


Alignment Length:523 Identity:141/523 - (26%)
Similarity:248/523 - (47%) Gaps:94/523 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIIWSCGTLAADILMATQGGTKSHKIPFWELAKGLISRGHNITFLSGFPADFNIEGLLEV-TPAG 72
            :::|.|              ..||.:....:.:.||.|||.:|.|:     .:...|::. .|:.
Human    26 VLVWPC--------------DMSHWLNVKVILEELIVRGHEVTVLT-----HSKPSLIDYRKPSA 71

  Fly    73 L-VEYIH--------NYTNWDLLGSRMAGEMPIKPWDG----------LRYAFE-SCDAML-RDS 116
            | .|.:|        |....||..:.:.|   :..|..          :|...: .|::.: ..:
Human    72 LKFEVVHMPQDRTEENEIFVDLALNVLPG---LSTWQSVIKLNDFFVEIRGTLKMMCESFIYNQT 133

  Fly   117 ETKELTKKSFDLAILDGAFPECFLGLMYD-FKIPFMYINTVGFYTGSISTAGN----------PV 170
            ..|:|.:.::|:.::|...| |. .||.: ..:||:       .|..||..||          |:
Human   134 LMKKLQETNYDVMLIDPVIP-CG-DLMAELLAVPFV-------LTLRISVGGNMERSCGKLPAPL 189

  Fly   171 SYAITPNFYSRFTDTMNLYERAINTAMQIGQTLMHMYVMRRTHLVMREHLGTQIPHPYEMSRNVS 235
            ||...|  .:..||.|...||..|:.:.:   |.|.::....:....|.....:..|..:...| 
Human   190 SYVPVP--MTGLTDRMTFLERVKNSMLSV---LFHFWIQDYDYHFWEEFYSKALGRPTTLCETV- 248

  Fly   236 FILQNGHAVL---------SYPRAFNPNVAEVACIHCRPARKLPR------NLEEFIGASGASGF 285
                 |.|.:         .:|:.:.||...|..:||:||:.||:      .:|.|:.:||..|.
Human   249 -----GKAEIWLIRTYWDFEFPQPYQPNFEFVGGLHCKPAKALPKINFYLQEMENFVQSSGEDGI 308

  Fly   286 IYVSMGSSVKAANMPEALRHMLVKTFARLPYHVLWKYEGSSTDIKDITSNVKLSRWLPQQDILGH 350
            :..|:||..:  |:.|...:::....|::|..|||:|:|...  ..:.:|.:|..|:||.|:|||
Human   309 VVFSLGSLFQ--NVTEEKANIIASALAQIPQKVLWRYKGKKP--STLGANTRLYDWIPQNDLLGH 369

  Fly   351 PKLRAFVTHGGLLSMFETVYHGVPVVTMPVFCDHDVNSAKAEVDGYAIKLDLQTLSANQLYKAIM 415
            ||.:||:||||:..::|.:|||||:|.:|:|.|...|.|..:..|.|::::.:|:::..|.:|:.
Human   370 PKTKAFITHGGMNGIYEAIYHGVPMVGVPIFGDQLDNIAHMKAKGAAVEINFKTMTSEDLLRALR 434

  Fly   416 KVIHNPRYRNSARHRQKLFLDQRSTALDTAIYWTEYVLRHNGAYHLQTPSRNMTWWQYYLLDVVA 480
            .||.:..|:.:|....::..||....||.|::|.|:|:||.||.||::.:.::||:|:|.:||:.
Human   435 TVITDSSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRSAAHDLTWFQHYSIDVIG 499

  Fly   481 VYL 483
            ..|
Human   500 FLL 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 118/453 (26%)
egt <172..479 CDD:223071 99/321 (31%)
UGT2A3XP_011530549.1 UDPGT 24..528 CDD:278624 141/523 (27%)
egt <267..498 CDD:223071 83/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - otm40389
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.