DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and UGT2B15

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001067.2 Gene:UGT2B15 / 7366 HGNCID:12546 Length:530 Species:Homo sapiens


Alignment Length:568 Identity:173/568 - (30%)
Similarity:272/568 - (47%) Gaps:89/568 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKKIALFLII-----WSCGTLAADILMATQGGTKSHKIPFWELAKGLISRGHNITFLSG-----F 56
            ||..::||:|     :|.|:....::..|:   .||.|....:.:.|:.|||.:|.|:.     .
Human     3 LKWTSVFLLIQLSCYFSSGSCGKVLVWPTE---YSHWINMKTILEELVQRGHEVTVLTSSASTLV 64

  Fly    57 PADFNIEGLLEVTPAGLVEYIHNY-------------------TNWDLLGSRMAGEMPIKPWDGL 102
            .|..:....|||.|..|.:   ||                   |.|...     .::....|:..
Human    65 NASKSSAIKLEVYPTSLTK---NYLEDSLLKILDRWIYGVSKNTFWSYF-----SQLQELCWEYY 121

  Fly   103 RYAFESC-DAMLRDSETKELTKKSFDLAILDGAFPECFLGLMYDFKIPFMYI--NTVGFYTGSIS 164
            .|:.:.| ||:|......:|.:..||:.:.|...| |...|...|.|||:|.  .:|| ||...:
Human   122 DYSNKLCKDAVLNKKLMMKLQESKFDVILADALNP-CGELLAELFNIPFLYSLRFSVG-YTFEKN 184

  Fly   165 TAG--NPVSYAITPNFYSRFTDTMNLYERAINTAMQIGQTLMHM---------YVMRRTHLVMRE 218
            ..|  .|.||  .|...|..:|.|...||..|        ::||         |.:::......|
Human   185 GGGFLFPPSY--VPVVMSELSDQMIFMERIKN--------MIHMLYFDFWFQIYDLKKWDQFYSE 239

  Fly   219 HLGTQIPHP---YEMSRNVSFILQNGHAVLSYPRAFNPNVAEVACIHCRPARKLPRNLEEFIGAS 280
            .||    .|   :|........|...:....:||.|.|||..|..:||:||:.||:.:|||:.:|
Human   240 VLG----RPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSS 300

  Fly   281 GASGFIYVSMGSSVKAANMPEALRHMLVKTFARLPYHVLWKYEGSSTDIKDITSNVKLSRWLPQQ 345
            |.:|.:..|:||.:  :||.|...:|:....|::|..|||:::|...:  .:.||.:|.:||||.
Human   301 GENGIVVFSLGSMI--SNMSEESANMIASALAQIPQKVLWRFDGKKPN--TLGSNTRLYKWLPQN 361

  Fly   346 DILGHPKLRAFVTHGGLLSMFETVYHGVPVVTMPVFCDHDVNSAKAEVDGYAIKLDLQTLSANQL 410
            |:|||||.:||:||||...::|.:|||:|:|.:|:|.|...|.|..:..|.|:.:|::|:|:..|
Human   362 DLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDL 426

  Fly   411 YKAIMKVIHNPRYRNSARHRQKLFLDQRSTALDTAIYWTEYVLRHNGAYHLQTPSRNMTWWQYYL 475
            ..|:..||::|.|:.:.....::..||....||.|::|.|:|:||.||.||:..:.|:||.||:.
Human   427 LNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHS 491

  Fly   476 LDVVAVYLILLYVLILALRRIDFPYEKVRSLYSLMAPFITIAKTKSKK 523
            |||:|..|..:..:|..:.:           :.|.. |..:||...||
Human   492 LDVIAFLLACVATVIFIITK-----------FCLFC-FRKLAKKGKKK 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 134/446 (30%)
egt <172..479 CDD:223071 111/318 (35%)
UGT2B15NP_001067.2 egt 8..508 CDD:223071 165/530 (31%)
UDPGT 24..518 CDD:278624 161/536 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - otm40389
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.