DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and UGT2B7

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001065.2 Gene:UGT2B7 / 7364 HGNCID:12554 Length:529 Species:Homo sapiens


Alignment Length:542 Identity:158/542 - (29%)
Similarity:259/542 - (47%) Gaps:82/542 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKKIALFLII-----WSCGTLAADILMATQGGTKSHKIPFWELAKGLISRGHNITFLSGFPA--- 58
            :|..::.|:|     :|.|.....::.|.:   .||.:....:...||.|||.:|.|:...:   
Human     3 VKWTSVILLIQLSFCFSSGNCGKVLVWAAE---YSHWMNIKTILDELIQRGHEVTVLASSASILF 64

  Fly    59 DFNIEGLL--EVTPAGLVE-YIHNYTNWDLLGSRMAGEMPIKPWDGL-RYAF------------- 106
            |.|....|  |:.|..|.: .:.|:.           ...||.|..| :..|             
Human    65 DPNNSSALKIEIYPTSLTKTELENFI-----------MQQIKRWSDLPKDTFWLYFSQVQEIMSI 118

  Fly   107 ------ESC-DAMLRDSETKELTKKSFDLAILDGAFPECFLGLMYDFKIPFMYINTVGF---YTG 161
                  :.| |.:......|::.:..||:...|..|| |...|...|.|||:|  ::.|   ||.
Human   119 FGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFP-CSELLAELFNIPFVY--SLSFSPGYTF 180

  Fly   162 SISTAG--NPVSYAITPNFYSRFTDTMNLYERAINTAMQIGQTLMHMYV-----------MRRTH 213
            ...:.|  .|.||  .|...|..||.|...||..|.          :||           |::..
Human   181 EKHSGGFIFPPSY--VPVVMSELTDQMTFMERVKNM----------IYVLYFDFWFEIFDMKKWD 233

  Fly   214 LVMREHLGTQIPHPYEMSRNVSFILQNGHAVLSYPRAFNPNVAEVACIHCRPARKLPRNLEEFIG 278
            ....|.||........|.:...::::|... ..:|....|||..|..:||:||:.||:.:|:|:.
Human   234 QFYSEVLGRPTTLSETMGKADVWLIRNSWN-FQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQ 297

  Fly   279 ASGASGFIYVSMGSSVKAANMPEALRHMLVKTFARLPYHVLWKYEGSSTDIKDITSNVKLSRWLP 343
            :||.:|.:..|:||.|  :||.|...:::....|::|..|||:::|:..|...:  |.:|.:|:|
Human   298 SSGENGVVVFSLGSMV--SNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGL--NTRLYKWIP 358

  Fly   344 QQDILGHPKLRAFVTHGGLLSMFETVYHGVPVVTMPVFCDHDVNSAKAEVDGYAIKLDLQTLSAN 408
            |.|:|||||.|||:||||...::|.:|||:|:|.:|:|.|...|.|..:..|.|:::|..|:|:.
Human   359 QNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTMSST 423

  Fly   409 QLYKAIMKVIHNPRYRNSARHRQKLFLDQRSTALDTAIYWTEYVLRHNGAYHLQTPSRNMTWWQY 473
            .|..|:.:||::|.|:.:.....::..||....||.|::|.|:|:||.||.||:..:.::||:||
Human   424 DLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQY 488

  Fly   474 YLLDVVAVYLILLYVLILALRR 495
            :.|||:...|:.:..:|..:.:
Human   489 HSLDVIGFLLVCVATVIFIVTK 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 129/448 (29%)
egt <172..479 CDD:223071 107/317 (34%)
UGT2B7NP_001065.2 UDPGT 24..525 CDD:278624 153/521 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - otm40389
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.