DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and UGT2B4

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_066962.2 Gene:UGT2B4 / 7363 HGNCID:12553 Length:528 Species:Homo sapiens


Alignment Length:533 Identity:160/533 - (30%)
Similarity:262/533 - (49%) Gaps:67/533 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ALFLIIWSC----GTLAADILMATQGGTKSHKIPFWELAKGLISRGHNITFLSGFPA---DFNIE 63
            ||.||..||    |:....::..|:   .||.:....:...|:.|||.:|.|:...:   |.|..
Human     8 ALLLIQLSCYFSSGSCGKVLVWPTE---FSHWMNIKTILDELVQRGHEVTVLASSASISFDPNSP 69

  Fly    64 GLL--EVTPAGLVEYIHNYTNWDLLGSRMAGEMPIKPW-----------------------DGLR 103
            ..|  ||.|..|.:     |.::.:..::     :|.|                       |.||
Human    70 STLKFEVYPVSLTK-----TEFEDIIKQL-----VKRWAELPKDTFWSYFSQVQEIMWTFNDILR 124

  Fly   104 YAFESC-DAMLRDSETKELTKKSFDLAILDGAFPECFLGLMYD-FKIPFMYINTVGFYTGSI--S 164
               :.| |.:......|:|.:..||:.:.|..||  |..|:.: .||||:|  ::.|..|..  .
Human   125 ---KFCKDIVSNKKLMKKLQESRFDVVLADAVFP--FGELLAELLKIPFVY--SLRFSPGYAIEK 182

  Fly   165 TAGN---PVSYAITPNFYSRFTDTMNLYERAINTAMQI-GQTLMHMYVMRRTHLVMREHLGTQIP 225
            .:|.   |.||  .|...|..:|.|...||..|....: .:....::.|::......|.||....
Human   183 HSGGLLFPPSY--VPVVMSELSDQMTFIERVKNMIYVLYFEFWFQIFDMKKWDQFYSEVLGRPTT 245

  Fly   226 HPYEMSRNVSFILQNGHAVLSYPRAFNPNVAEVACIHCRPARKLPRNLEEFIGASGASGFIYVSM 290
            ....|::...::::| :....:|....|||..|..:||:||:.||:.:|||:.:||.:|.:..|:
Human   246 LSETMAKADIWLIRN-YWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSL 309

  Fly   291 GSSVKAANMPEALRHMLVKTFARLPYHVLWKYEGSSTDIKDITSNVKLSRWLPQQDILGHPKLRA 355
            ||.|  :|..|...:::....|::|..|||:::|:..|...:  |.:|.:|:||.|:|||||.||
Human   310 GSMV--SNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGL--NTRLYKWIPQNDLLGHPKTRA 370

  Fly   356 FVTHGGLLSMFETVYHGVPVVTMPVFCDHDVNSAKAEVDGYAIKLDLQTLSANQLYKAIMKVIHN 420
            |:||||...::|.:|||:|:|.:|:|.|...|.|..:..|.|:.||..|:|:..|..|:..||::
Human   371 FITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTMSSTDLLNALKTVIND 435

  Fly   421 PRYRNSARHRQKLFLDQRSTALDTAIYWTEYVLRHNGAYHLQTPSRNMTWWQYYLLDVVAVYLIL 485
            |.|:.:|....::..||....||.|::|.|:|:||.||.||:..:.::||:||:.|||....|..
Human   436 PLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVTGFLLAC 500

  Fly   486 LYVLILALRRIDF 498
            :..:|..:.:..|
Human   501 VATVIFIITKCLF 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 128/441 (29%)
egt <172..479 CDD:223071 106/307 (35%)
UGT2B4NP_066962.2 egt 8..512 CDD:223071 159/530 (30%)
UDPGT 24..524 CDD:278624 153/517 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - otm40389
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.