DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and Ugt2a3

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_082370.2 Gene:Ugt2a3 / 72094 MGIID:1919344 Length:534 Species:Mus musculus


Alignment Length:530 Identity:148/530 - (27%)
Similarity:250/530 - (47%) Gaps:88/530 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIIWSCGTLAADILMATQGGTKSHKIPFWELAKGLISRGHNITFL----------SGFPADF-NI 62
            :::|.|              ..||.:....:.:.|.:|||.:|.|          ...|..| ||
Mouse    26 VLVWPC--------------DMSHWLNLKTILEELGARGHEVTVLKYPSIIIDQSKRIPLHFENI 76

  Fly    63 EGLLEVTPAG---------LVEYIHNYTNWDLLGS------RMAGEMPIKPWDGLRYAFES-CDA 111
            ..|.|:..|.         .|..|.|.:.|:...:      ::.|:            ||| |.:
Mouse    77 PLLYEIETAENRLNEIANLAVNVIPNLSLWEAAKTLQDFFLQVTGD------------FESICRS 129

  Fly   112 MLRDSE-TKELTKKSFDLAILDGAFPECFLGLMYDFKIPFMYI--NTVGFY----TGSISTAGNP 169
            :|.:.: ..:|....:|:.::|...| |...:....:|||:|.  .::|:|    .|.:     |
Mouse   130 VLYNQKFMDKLRDAQYDVVVIDPVVP-CGELVAEVLQIPFVYTLRFSMGYYMEKHCGQL-----P 188

  Fly   170 VSYAITPNFYSRFTDTMNLYERAINTAMQIGQTLMHMYVMRRTHLVMREHLGTQIPHPYEMSRNV 234
            :..:..|...|..||.|...||..|...    :|:..|.:::......:...::     .:.|..
Mouse   189 IPLSYVPVVMSELTDNMTFTERVKNMMF----SLLFEYWLQQYDFAFWDQFYSE-----TLGRPT 244

  Fly   235 SFILQNGHAVL---------SYPRAFNPNVAEVACIHCRPARKLPRNLEEFIGASGASGFIYVSM 290
            :|....|.|.:         .:||.:.||...|..:||:||:.||:.:|||:.:||..|.:..|:
Mouse   245 TFCKTVGKADIWLIRTYWDVEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFVQSSGEHGVVVFSL 309

  Fly   291 GSSVKAANMPEALRHMLVKTFARLPYHVLWKYEGSSTDIKDITSNVKLSRWLPQQDILGHPKLRA 355
            ||.||  |:.|...:::....|::|..|||:|.|...  ..:.||.:|..|:||.|:|||||.:|
Mouse   310 GSMVK--NLTEEKANLIASVLAQIPQKVLWRYSGKKP--ATLGSNTRLFNWIPQNDLLGHPKTKA 370

  Fly   356 FVTHGGLLSMFETVYHGVPVVTMPVFCDHDVNSAKAEVDGYAIKLDLQTLSANQLYKAIMKVIHN 420
            |:||||...::|.:|||||:|.:|:..|...|.|..|..|.|:|:.:.|:::..|..|:..||:.
Mouse   371 FITHGGTNGIYEAIYHGVPMVGVPMLGDQPHNIAHMEAKGAALKVSISTMTSTDLLSAVRAVINE 435

  Fly   421 PRYRNSARHRQKLFLDQRSTALDTAIYWTEYVLRHNGAYHLQTPSRNMTWWQYYLLDVVAVYLIL 485
            |.|:.:|....::..||....||.|::|.|:|:||.||.||:..:.:::|:||:.|||:...|:.
Mouse   436 PSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLSWFQYHSLDVIGFLLLC 500

  Fly   486 LYVLILALRR 495
            :..|...:.:
Mouse   501 VVTLTFIITK 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 124/448 (28%)
egt <172..479 CDD:223071 105/315 (33%)
Ugt2a3NP_082370.2 UDPGT 25..526 CDD:278624 148/530 (28%)
egt <268..507 CDD:223071 93/242 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - otm42461
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.