DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and Ugt2a2

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001019319.1 Gene:Ugt2a2 / 552899 MGIID:3576095 Length:528 Species:Mus musculus


Alignment Length:564 Identity:172/564 - (30%)
Similarity:265/564 - (46%) Gaps:80/564 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKKIALFLIIWSCGTLAADILMA------TQGGTKSHKIPFWELAKGLISRGHNITFL------ 53
            |:||:...||...  |||..:|..      |.|   ||.:....|.:.|:.|.|::|.|      
Mouse     1 MIKKVLQLLIFHL--TLAEIVLSGNVVVWPTDG---SHWLNIKILLEELVQRNHSVTVLAPSETL 60

  Fly    54 ---SGFPADFNIEGL-LEVTPAGLVEYI-HNYTNWDLLGSRMAGEMPIKPW------DGLRYAF- 106
               |...|..|.|.: :..|.:.:.|.| |....|  |..|   ..|:..|      ..|...| 
Mouse    61 FINSRLDAFINFEEIPVSYTKSKIDEIIEHMIALW--LDHR---PTPLTMWTFYKELGNLLATFY 120

  Fly   107 ----ESCDAMLRDSETKE-LTKKSFDLAILDGAFPECFLGLMYDFK--IPFMY------INTVGF 158
                :.||.:|.:....| |.|..||:.:.|   |....|.:...|  |||:|      ..||..
Mouse   121 TTNKQMCDGVLNNPTVMERLQKGGFDVLLAD---PVTMCGELVALKLGIPFVYTLRFSPAFTVER 182

  Fly   159 YTGSISTAGNPVSYAITPNFYSRFTDTMNLYERAINTAMQIGQTLMHMYVMRRTHLVMREHLGTQ 223
            :.|.|..   |:||  .|...|..||.|:..||..|.   |..:|.. |:.:........:....
Mouse   183 HCGKIPA---PISY--VPAALSELTDQMSFGERVKNI---ISYSLQD-YIFKTYWGEWNSYYSKV 238

  Fly   224 IPHP---YEMSRNVSFILQNGHAVLSYPRAFNPNVAEVACIHCRPARKLPRNLEEFIGASGASGF 285
            :..|   .|........|...:....:||.:.||...|..:||:||:.||:.:|||:..||..|.
Mouse   239 LGRPTTLCETMGKAEIWLMRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFVQTSGEHGI 303

  Fly   286 IYVSMGSSVKAANMPEALRHMLVKTFARLPYHVLWKYEGSSTDIKDITSNVKLSRWLPQQDILGH 350
            :..|:||.||  |:.:...:::....|::|..|||:|:|...|  .:.||.:|..|:||.|:|||
Mouse   304 VVFSLGSMVK--NLTDEKANLIASALAQIPQKVLWRYKGKIPD--TLGSNTRLFDWIPQNDLLGH 364

  Fly   351 PKLRAFVTHGGLLSMFETVYHGVPVVTMPVFCDHDVNSAKAEVDGYAIKLDLQTLSANQLYKAIM 415
            ||.|||:||||...::|.:|||:|:|.:|:|.|...|.|..:..|.|:::::.|::::.|..|:.
Mouse   365 PKTRAFITHGGTNGIYEAIYHGIPMVGVPMFADQPDNIAHMKAKGAAVEVNMNTMTSSDLLNALR 429

  Fly   416 KVIHNPRYRNSARHRQKLFLDQRSTALDTAIYWTEYVLRHNGAYHLQTPSRNMTWWQYYLLDVVA 480
            .||:.|.|:.:|....::..||....||.|::|.|:|:||.||.||:..:.:::|:||:.|||:.
Mouse   430 TVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLSWFQYHSLDVIG 494

  Fly   481 VYLILLYVLILALRRID-FPYEKVRSLYSLMAPFITIAKTKSKK 523
            ..|..:...||.:.:.. |.::||             .||..||
Mouse   495 FLLACVASAILLVAKCCLFIFQKV-------------GKTGKKK 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 131/439 (30%)
egt <172..479 CDD:223071 105/309 (34%)
Ugt2a2NP_001019319.1 UDPGT 22..516 CDD:278624 157/517 (30%)
egt <267..487 CDD:223071 85/223 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - otm42461
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.