DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and RGD1559459

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_003751392.1 Gene:RGD1559459 / 501907 RGDID:1559459 Length:530 Species:Rattus norvegicus


Alignment Length:511 Identity:145/511 - (28%)
Similarity:246/511 - (48%) Gaps:79/511 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SHKIPFWELAKGLISRGHNITFL------------------SGFPADFNIEGLLEVTPAGLVEYI 77
            ||.:....:...|:.:||.:..|                  ..||:.::|..:..:....:.|.|
  Rat    34 SHWLNLKIILSELVKKGHEVVVLKPSVSFSYEVDKTSAIEFESFPSSYSIADVEVIFMDCVNESI 98

  Fly    78 HNYTNWDLLGSRMAGEMPIKPWDG----LRYAFES----CDAMLRDSE-TKELTKK----SFDLA 129
            :              |:|.:.:.|    |:..||.    .:.:.||:. .|||..|    .||:.
  Rat    99 Y--------------ELPKQSFWGYFLMLQKLFERTSDYSERLCRDAAFNKELMTKLQNSGFDVI 149

  Fly   130 ILDGAFPECFLGLMYDFKIPFMYINTVGFYTGSI---STAGNPVSYAITPNFYSRFTDTMNLYER 191
            :.| .|..|...|....|||.:|  ::.|:.||.   .:.|.|:..:..|...|..:|.|...||
  Rat   150 LAD-PFTPCGDLLAEILKIPLVY--SLRFFPGSTYEKYSGGLPMPPSYVPIAMSELSDRMTFVER 211

  Fly   192 AINTAMQIGQTLMHM-YVM-----------RRTHLVMREHLGTQIPHPYEMSRNVSFILQNGHAV 244
                       :.|| ||:           ::.:.:..|.||........|::...::::. :..
  Rat   212 -----------VKHMIYVLCFDFWFQVFDEKKWNELYTEVLGRPTTLSETMAKADIWLIRT-YWD 264

  Fly   245 LSYPRAFNPNVAEVACIHCRPARKLPRNLEEFIGASGASGFIYVSMGSSVKAANMPEALRHMLVK 309
            |.:|....||...|..:|||||:.||:.:|:|:.:||..|.:..|:||.|  .::.|...:::..
  Rat   265 LEFPHPVLPNFDFVGGLHCRPAKPLPKEIEDFVQSSGEHGVVVFSLGSMV--GSLTEERANVIAA 327

  Fly   310 TFARLPYHVLWKYEGSSTDIKDITSNVKLSRWLPQQDILGHPKLRAFVTHGGLLSMFETVYHGVP 374
            ..|::|..|||::||...:  .:.||.:|.:|:||.|:|||||.|||:||||...::|.:|||:|
  Rat   328 GLAQIPQKVLWRFEGKKPE--TLGSNTRLYKWIPQNDLLGHPKTRAFITHGGTNGIYEAIYHGIP 390

  Fly   375 VVTMPVFCDHDVNSAKAEVDGYAIKLDLQTLSANQLYKAIMKVIHNPRYRNSARHRQKLFLDQRS 439
            ||.:|:|.|...|....:..|.|::||..|:|:..|..|:..|.::|.|:.:|....::..||..
  Rat   391 VVGIPLFGDQKDNIVHLKTKGAAVRLDFLTMSSTDLLTALRTVTNDPSYKENAMRLSRIHHDQPV 455

  Fly   440 TALDTAIYWTEYVLRHNGAYHLQTPSRNMTWWQYYLLDVVAVYLILLYVLILALRR 495
            ..||.|::|.|:|:||.||.||:....:::|.||:.|||:...|..:..::..|::
  Rat   456 KPLDRAVFWIEFVMRHKGAKHLRVAGHDLSWVQYHSLDVIGFLLACVVTVMFILKK 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 123/448 (27%)
egt <172..479 CDD:223071 104/318 (33%)
RGD1559459XP_003751392.1 UDPGT 24..527 CDD:278624 145/511 (28%)
egt <270..508 CDD:223071 90/241 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - otm44525
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.