DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and Ugt2b10

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001178605.1 Gene:Ugt2b10 / 305264 RGDID:1309989 Length:532 Species:Rattus norvegicus


Alignment Length:500 Identity:143/500 - (28%)
Similarity:244/500 - (48%) Gaps:57/500 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SHKIPFWELAKGLISRGHNITFL------------------SGFPADFNIEGLLEVTPAGLVEYI 77
            ||.:....:...|:.:||.:|.|                  ..:|..:::..:.|.....|.:||
  Rat    36 SHWLNLRVILDELLKKGHEVTVLRPSASLSYEVDNTSAIEFETYPTSYSLTEVDEFFWESLRKYI 100

  Fly    78 HNYTNWDLLGSRMAGEMPIKPWDGLRYAFES-C-DAMLRDSETKELTKKSFDLAILDGAFPECFL 140
            :........|..:..:..:  |....| ||| | |.:.......:|....||:.:.|...| |..
  Rat   101 YELPKQSFWGYFLMFQELV--WVDSDY-FESLCKDVVFNKELMTKLQNSGFDVILADPFIP-CGD 161

  Fly   141 GLMYDFKIPFMYINTVGFYTGSI---STAGNPVSYAITPNFYSRFTDTMNLYERAINTAMQIGQT 202
            .|....|||.:|  ::.|:.||.   .:.|.|:..:..|...|..:|.|...||           
  Rat   162 LLAEILKIPLVY--SLRFFPGSTYEKYSGGLPMPPSYVPIAMSELSDRMTFVER----------- 213

  Fly   203 LMHM-YVM-----------RRTHLVMREHLGTQIPHPYEMSRNVSFILQNGHAVLSYPRAFNPNV 255
            :.|| ||:           ::.:.:..|.||........|::...::::. :..|.:|....||.
  Rat   214 MKHMIYVLCFDFWFQAFNEKKWNELYTEVLGRPTTLSETMAKADIWLIRT-YWDLEFPHPVLPNF 277

  Fly   256 AEVACIHCRPARKLPRNLEEFIGASGASGFIYVSMGSSVKAANMPEALRHMLVKTFARLPYHVLW 320
            ..|..:|||||:.||:.:|:|:.:||..|.:..|:||.|  .|:.|...:::....|::|..|||
  Rat   278 DFVGGLHCRPAKPLPKEIEDFVQSSGEHGVVVFSLGSMV--GNLTEERANVIAAGLAQIPQKVLW 340

  Fly   321 KYEGSSTDIKDITSNVKLSRWLPQQDILGHPKLRAFVTHGGLLSMFETVYHGVPVVTMPVFCDHD 385
            ::||...:  .:.||.:|.:|:||.|:|||||.|||:||||...::|.:|||:|||.:|:|.|..
  Rat   341 RFEGKKPE--TLGSNTRLYKWIPQNDLLGHPKTRAFITHGGTNGIYEAIYHGIPVVGIPLFGDQY 403

  Fly   386 VNSAKAEVDGYAIKLDLQTLSANQLYKAIMKVIHNPRYRNSARHRQKLFLDQRSTALDTAIYWTE 450
            .|....:..|.|::||..|:|:..|:.|:..:.::|.|:.:|....::..||....||.|::|.|
  Rat   404 DNIVHLKTKGAAVRLDFLTMSSTDLFTALKTITNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIE 468

  Fly   451 YVLRHNGAYHLQTPSRNMTWWQYYLLDVVAVYLILLYVLILALRR 495
            :|:||.||.||:..:.:::|.||:.|||:...|..:..::..|::
  Rat   469 FVMRHKGAKHLRVAAHDLSWVQYHSLDVIGFLLACVVTVMFILKK 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 121/437 (28%)
egt <172..479 CDD:223071 104/318 (33%)
Ugt2b10NP_001178605.1 UDPGT 26..529 CDD:278624 143/499 (29%)
egt 35..510 CDD:223071 142/495 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.