DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt50B3 and UGT3A2

DIOPT Version :9

Sequence 1:NP_001260710.1 Gene:Ugt50B3 / 246614 FlyBaseID:FBgn0050438 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_011512290.1 Gene:UGT3A2 / 167127 HGNCID:27266 Length:550 Species:Homo sapiens


Alignment Length:531 Identity:147/531 - (27%)
Similarity:232/531 - (43%) Gaps:85/531 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AADIL-MATQGGTKSHKIPFWELAKGLISRGHNITFLSGFPADFNIEGLLEVTPAGL-----VEY 76
            ||.|| ::|.||  ||.:....:::.|...|||:|.|:.....| :.||.: :||..     :.|
Human    22 AAKILTISTVGG--SHYLLMDRVSQILQDHGHNVTMLNHKRGPF-MPGLSD-SPASASRYPRILY 82

  Fly    77 IHNYTNWDL------------------------------------LGSRMAGEMPIKPWDGLRYA 105
            :..|..:.|                                    ||.|...|..:   :.|.|.
Human    83 LQKYCQFGLKDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEETLGGRGKFENLL---NVLEYL 144

  Fly   106 FESCDAMLRDSETKE-LTKKSFDLAILDGAFPECFLGLMYDFKIPFMYINTVGFYTGSISTAGNP 169
            ...|...|...:..: |..::||:.|:: .|..|...:......||:.|.:..|  ||:. .|.|
Human   145 ALQCSHFLNRKDIMDSLKNENFDMVIVE-TFDYCPFLIAEKLGKPFVAILSTSF--GSLE-FGLP 205

  Fly   170 VSYAITPNFYSRFTDTMNLYERAINTAMQIGQTLMHMYVMRRTHL------VMREHLGTQIPHP- 227
            :..:..|.|.|..||.|:.:.|..|..|      ...:..|:.|:      .::||. |:...| 
Human   206 IPLSYVPVFRSLLTDHMDFWGRVKNFLM------FFSFCRRQQHMQSTFDNTIKEHF-TEGSRPV 263

  Fly   228 ---YEMSRNVSFILQNGHAVLSYPRAFNPNVAEVACIHCRPARKLPRNLEEFIGASGASGFIYVS 289
               ..:...:.||  |......:.|...||...|..:..:|.:.:|::||.||...|.|||:.|:
Human   264 LSHLLLKAELWFI--NSDFAFDFARPLLPNTVYVGGLMEKPIKPVPQDLENFIAKFGDSGFVLVT 326

  Fly   290 MGSSVKAANMPEALRHMLVKTFARLPYHVLWKYEGSSTDIKDI--TSNVKLSRWLPQQDILGHPK 352
            :||.|.....||..:.| ...||.||..|:||.:.|... ||:  .:|||:..||||.|:|.||.
Human   327 LGSMVNTCQNPEIFKEM-NNAFAHLPQGVIWKCQCSHWP-KDVHLAANVKIVDWLPQSDLLAHPS 389

  Fly   353 LRAFVTHGGLLSMFETVYHGVPVVTMPVFCDHDVNSAKAEVDGYAIKLDLQTLSANQLYKAIMKV 417
            :|.||||||..|:.|.:.||||:|.:|:|.|...|..:.|...:.:.:.|:.|.|..|...:.::
Human   390 IRLFVTHGGQNSIMEAIQHGVPMVGIPLFGDQPENMVRVEAKKFGVSIQLKKLKAETLALKMKQI 454

  Fly   418 IHNPRYRNSARHRQKLFLDQRSTALDTAIYWTEYVLRHNGAYHLQTPSRNMTWWQYYLLDVVAVY 482
            :.:.||:::|.....:......:.....:.|.::||:..||.||:.......|.:.|||||    
Human   455 MEDKRYKSAAVAASVILRSHPLSPTQRLVGWIDHVLQTGGATHLKPYVFQQPWHEQYLLDV---- 515

  Fly   483 LILLYVLILAL 493
                :|.:|.|
Human   516 ----FVFLLGL 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt50B3NP_001260710.1 YjiC 28..434 CDD:224732 125/459 (27%)
egt <172..479 CDD:223071 98/318 (31%)
UGT3A2XP_011512290.1 UDPGT 23..518 CDD:278624 143/524 (27%)
egt <162..517 CDD:223071 112/377 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45374
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.