Sequence 1: | NP_726512.1 | Gene: | CG30429 / 246609 | FlyBaseID: | FBgn0050429 | Length: | 305 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001139500.1 | Gene: | JPH4 / 84502 | HGNCID: | 20156 | Length: | 628 | Species: | Homo sapiens |
Alignment Length: | 311 | Identity: | 62/311 - (19%) |
---|---|---|---|
Similarity: | 90/311 - (28%) | Gaps: | 162/311 - (52%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 FYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPEGQLIYEGDWV--MNKRQGVGSMLR 86
Fly 87 KRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQW---YN----------- 137
Fly 138 ------------------------------------------DG--------------------- 139
Fly 140 -----------------------------------------------------NIYAGEWETDFR 151
Fly 152 HGLGVMFYANGNRYEGHFARGYKNGEGVFYHMHT----GQIQKGMWENDNL 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30429 | NP_726512.1 | COG4642 | 59..194 | CDD:226989 | 48/270 (18%) |
JPH4 | NP_001139500.1 | PLN03185 | 5..>143 | CDD:215619 | 36/110 (33%) |
MORN 1 | 50..72 | 9/18 (50%) | |||
MORN 2 | 74..95 | 6/35 (17%) | |||
MORN 3 | 96..117 | 7/26 (27%) | |||
MORN 4 | 118..140 | 9/21 (43%) | |||
MORN 5 | 141..163 | 2/21 (10%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 158..214 | 2/55 (4%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 231..276 | 0/44 (0%) | |||
PLN03185 | 281..>340 | CDD:215619 | 22/62 (35%) | ||
MORN 7 | 317..339 | 5/26 (19%) | |||
MORN 8 | 340..362 | ||||
PRK07003 | <369..>606 | CDD:235906 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 415..602 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4642 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |