DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and AT1G77660

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_177889.1 Gene:AT1G77660 / 844102 AraportID:AT1G77660 Length:421 Species:Arabidopsis thaliana


Alignment Length:203 Identity:64/203 - (31%)
Similarity:94/203 - (46%) Gaps:29/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NKPVCSSGRRATFYYPGGGSYSGYWLCNKHQGWGVK---KTAKRTCQYFYGKKHPEG-QLIYEGD 72
            |:..|:..  ..:||...|.|.|.|:..::.|:|::   |.:|...||..|.:|..| ...|.||
plant   188 NRGKCNGS--GVYYYYVNGRYEGDWINGRYDGYGIECWSKGSKYKGQYKQGLRHGFGVYWFYTGD 250

  Fly    73 WVMNKRQGVGSMLRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQWYN 137
                                  .|||.|::....|.|.|..:||..:.|::....:||||...:.
plant   251 ----------------------SYSGEWFNGQSHGFGVQTCADGSSFVGEFKFGVKHGLGSYHFR 293

  Fly   138 DGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARGYKNGEGVFYHMHTGQIQKGMWENDNLKTSV 202
            :|:.||||:..|..||.||..:|||:.|||.:..|.|.|.|. |...||.|:.|.|::.||...:
plant   294 NGDKYAGEYFGDKIHGFGVYHFANGHYYEGAWHEGRKQGYGT-YRFRTGDIKSGEWDDGNLVNHL 357

  Fly   203 VQDEPKIR 210
            ..|...:|
plant   358 PLDSDPVR 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 45/135 (33%)
AT1G77660NP_177889.1 PLN03185 173..>351 CDD:215619 60/187 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23084
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.