DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and AT4G17080

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_193441.5 Gene:AT4G17080 / 827416 AraportID:AT4G17080 Length:513 Species:Arabidopsis thaliana


Alignment Length:251 Identity:71/251 - (28%)
Similarity:104/251 - (41%) Gaps:46/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CSSGRRATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRT---CQYFYGKKHPEG-QLIYEGDWVMN 76
            ||..  ..:||...|.|.|.|:..|:.|:||:..||.:   .||..|.:|..| ...|.||    
plant   271 CSGS--GVYYYSMKGKYEGDWIDGKYDGYGVETWAKGSRYRGQYRQGMRHGTGIYRFYTGD---- 329

  Fly    77 KRQGVGSMLRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQWYNDGNI 141
                              :|:|.|.:....|.|.....||..:.|::....:||||...:.:|:.
plant   330 ------------------VYAGEWSNGQSHGCGVYTSEDGSRFVGEFKWGVKHGLGHYHFRNGDT 376

  Fly   142 YAGEWETDFRHGLGVMFYANGNRYEGHFARGYKNGEGVFYHMHTGQIQKGMWENDNL-----KTS 201
            ||||:..|..||.||..:.||:||||.:..|.:.|.|: |....|:.|.|.||:..|     :|:
plant   377 YAGEYFADRMHGFGVYQFGNGHRYEGAWHEGRRQGLGM-YTFRNGETQAGHWEDGVLNCPTEQTT 440

  Fly   202 VVQDEPKIRCNAVITSYPIPRNYLKYPNEIMRDLFQRHKDFSNKPHRRFNDRVSLA 257
            .......|..:.|:.:....|...|...|::            |...|.|..|.:|
plant   441 RPDSSFSISHSKVVDTVQQARKAAKKAREVV------------KVEERVNRAVMVA 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 41/135 (30%)
AT4G17080NP_193441.5 EcfT 156..>219 CDD:410987
PLN03185 256..>415 CDD:215619 53/168 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23084
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.