DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and PIP5K3

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001324179.1 Gene:PIP5K3 / 817182 AraportID:AT2G26420 Length:719 Species:Arabidopsis thaliana


Alignment Length:194 Identity:54/194 - (27%)
Similarity:81/194 - (41%) Gaps:42/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NKHQGWGV--KKTAKR-----TCQY------------------FY------GKKHPEGQLI---- 68
            ||.|..||  |::::|     :|:.                  .|      |..|..|:.:    
plant    14 NKEQSLGVKYKQSSRRVVPMTSCEVSDTAAEIRIVEKVLKNGDLYNGGLSAGVPHGTGKYLWSDG 78

  Fly    69 --YEGDWVMNKRQGVGSMLRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGL 131
              |||:|...|..|.|......|.    .|.|::.|....|||.....||..|.|.|:..|:||.
plant    79 CMYEGEWTRGKASGKGRFSWPSGA----TYEGQFKDGRMDGEGTFIGIDGDTYRGHWLWGRKHGY 139

  Fly   132 GIQWYNDGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARGYKNGEGVFYHMHTGQIQKGMWEN 195
            |.:.|.:|:.|.|.|:.:.:.|.|...:::||.|.|.:..|..:|:|.....: |....|:|||
plant   140 GEKRYANGDGYQGNWKANLQDGNGRYVWSDGNEYVGEWKNGVISGKGKMTWAN-GNRYDGLWEN 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 42/140 (30%)
PIP5K3NP_001324179.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.