DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and MORN1

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_079124.1 Gene:MORN1 / 79906 HGNCID:25852 Length:497 Species:Homo sapiens


Alignment Length:159 Identity:45/159 - (28%)
Similarity:78/159 - (49%) Gaps:20/159 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VCSSGRRATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPEGQLIYEGDWVMNKRQ 79
            :...|||...:  .|.::||.::..:.||:||.:.....|              |||:.....|:
Human    71 ITGEGRRHWAW--SGDTFSGQFVLGEPQGYGVMEYKAGGC--------------YEGEVSHGMRE 119

  Fly    80 GVGSMLRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQWYNDGNIYAG 144
            |.|.::.:.|.    :|.|.::|:.:.|.|:..:.:|..|.|.|:::||.|.|:....||:.|.|
Human   120 GHGFLVDRDGQ----VYQGSFHDNKRHGPGQMLFQNGDKYDGDWVRDRRQGHGVLRCADGSTYKG 180

  Fly   145 EWETDFRHGLGVMFYANGNRYEGHFARGY 173
            :|.:|...|||.|.:.:|..|.|.:..|:
Human   181 QWHSDVFSGLGSMAHCSGVTYYGLWINGH 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 34/115 (30%)
MORN1NP_079124.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
MORN 39..61 CDD:280628
MORN 1 39..61
COG4642 59..191 CDD:226989 38/139 (27%)
MORN 2 62..84 3/14 (21%)
MORN 3 86..108 6/21 (29%)
MORN 4 109..131 7/25 (28%)
MORN 5 132..154 6/21 (29%)
MORN 155..177 CDD:280628 9/21 (43%)
MORN 6 155..177 9/21 (43%)
MORN 7 178..200 9/21 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..425
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 468..497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.