DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and rsph10b

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_004918035.1 Gene:rsph10b / 779504 XenbaseID:XB-GENE-5793212 Length:838 Species:Xenopus tropicalis


Alignment Length:280 Identity:76/280 - (27%)
Similarity:115/280 - (41%) Gaps:61/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQY----FYGKKHPEG-------QLIYEGDWV 74
            :..:.:..|.:|.|.:..|...|.|:.|.:..: ||    :...:|..|       ::.|.|||.
 Frog   119 KGKYTWKDGLTYEGDFYMNFPMGHGIYKWSDGS-QYEGEVYKAIRHGHGIFTSSNQKVSYVGDWH 182

  Fly    75 MNKRQGVGSM-LRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLG-IQWYN 137
            ...|.|.|.: ..|.||.   .|.|.|..:.|.|.|.|.:..|.:|.|:|..|..||:| ::|..
 Frog   183 KGTRHGKGVIYYNKEGTS---WYEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLT 244

  Fly   138 DGNIYAGEWETDFRHGLGV----------MFYANGNRYEGHFARGYKNGEGVFYHMHTGQIQKGM 192
            ....|||:||...::|.|.          ..|:..|.|.|:|..|.:.|:|.||:.: |.:..|.
 Frog   245 SNEEYAGQWENGIQNGSGTHTWFLRRIPGTQYSLRNEYVGNFVNGIRQGQGQFYYAN-GAMYDGE 308

  Fly   193 WENDNLKTSV---------------VQDEPKIRCNAVITSYPIPRNYLKYPNEIMRDL----FQR 238
            |:| |.|..:               |:|:        |..||   |: ||......||    .|.
 Frog   309 WKN-NKKHGLGKFVFKNGQIYVGEFVEDQ--------IAEYP---NF-KYDRVNTPDLSGIRTQS 360

  Fly   239 HKDFSNKPHRRFNDRV-SLA 257
            ..:.:.....|:|..: |||
 Frog   361 SMNLAGSSTSRYNTGIPSLA 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 47/153 (31%)
rsph10bXP_004918035.1 PLN03185 75..>122 CDD:215619 0/2 (0%)
PLN03185 103..>298 CDD:215619 52/182 (29%)
COG4642 <270..>336 CDD:226989 17/67 (25%)
tolA_full 693..>787 CDD:274303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.