DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and Morn3

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_083388.1 Gene:Morn3 / 74890 MGIID:1922140 Length:241 Species:Mus musculus


Alignment Length:249 Identity:79/249 - (31%)
Similarity:116/249 - (46%) Gaps:42/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CPNK----------PVCSSGRRATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPE 64
            ||.|          ....:|.|...:...|..|.|.|..|...|.|.:...|             
Mouse     6 CPRKVEPPWKGWDRKAQKNGLRHQVFAVNGDHYVGEWKGNLKHGKGTQVWKK------------- 57

  Fly    65 GQLIYEGDWVMNKRQGVGSMLR---KRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKN 126
            ...:|||||...||.|.||:..   :.| :::.:|||.|..|.|.|.|.||:.....|.|:|..|
Mouse    58 SGAVYEGDWKFGKRDGYGSLSHPDPETG-KLRRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCNN 121

  Fly   127 RRHGLGIQWYNDGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARGYKNGEGVFYHMHTGQIQKG 191
            :|.|.|..:||:|:||.|:|:.|...|.|::...|||||||.:.||.|||.|.|:|:..||:.:|
Mouse   122 QRSGWGRMYYNNGDIYEGQWQNDKPEGEGMLRLKNGNRYEGIWERGMKNGHGRFFHLDHGQLFEG 186

  Fly   192 MWENDNLKTSVVQD-------EPKIRCNAVITSYPIPRNYLKYPNEIMRDLFQR 238
            .|.::..|...:.|       ||        |.:|||:..:..|:.::::...:
Mouse   187 YWVDNVAKCGTMIDFGRDEAPEP--------TQFPIPKVEILDPDGVLKEALDK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 56/137 (41%)
Morn3NP_083388.1 PLN03185 34..>190 CDD:215619 65/169 (38%)
MORN 1 38..60 7/34 (21%)
MORN 2 62..84 10/21 (48%)
MORN 3 91..113 10/21 (48%)
MORN 4 114..136 10/21 (48%)
MORN 5 137..159 8/21 (38%)
MORN 6 160..182 11/21 (52%)
MORN 7 184..205 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842058
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H42069
Inparanoid 1 1.050 133 1.000 Inparanoid score I4586
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56904
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43699
orthoMCL 1 0.900 - - OOG6_105410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4901
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.700

Return to query results.
Submit another query.