DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and RSPH10B2

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_006715829.1 Gene:RSPH10B2 / 728194 HGNCID:34385 Length:875 Species:Homo sapiens


Alignment Length:335 Identity:82/335 - (24%)
Similarity:137/335 - (40%) Gaps:80/335 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FCPNKPVCSSGRRATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYF----YGKKHPEGQLI- 68
            |..|.|:    ....:.:|.|..|.|..:.....|:|:.|.:.:...|.    .||:|.:|.:. 
Human   136 FVKNVPM----NHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYY 196

  Fly    69 -------YEGDWVMNKRQGVGSMLRKRGTEVQLIYSGRWYDDMKCGEGK-QFYSDGCVYFGKWIK 125
                   ||||||.|.::|.|....|.|.    ||.|:|.|:|:.|||: ::.:....|.|:|.:
Human   197 NQEGTCWYEGDWVQNIKKGWGIRCYKSGN----IYEGQWEDNMRHGEGRMRWLTTNEEYTGRWER 257

  Fly   126 NRRHGLGIQ-W---------YNDGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARGYKNGEGVF 180
            ..::|.|.. |         |...|.|.||:...:|||.|..:||:|..|:|.:....|:  |:|
Human   258 GIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSNKKH--GMF 320

  Fly   181 YHMH------TGQIQKGMWENDNLKTSVVQDEPKIRCNAVITSYPIPRNYLKYPNEIMRDLFQRH 239
            :.:.      .|::.:|.:.||::......:...|.| ..::|...||  |....|::|.|    
Human   321 FCLQGRLTFKNGRVYEGAFSNDHIAGFPDLEVEFISC-LDLSSGVAPR--LSRSAELIRKL---- 378

  Fly   240 KDFSNKPHRRFNDRVSLAFIHHHRQYASCEERFASPTIVDLYP---------RAEFGCTCDCENV 295
              ..::.|......:.|..                ..::|:||         :.|:.       |
Human   379 --DGSESHSVLGSSIELDL----------------NLLLDMYPETVQPEEKKQVEYA-------V 418

  Fly   296 ARNETNISQI 305
            .||.|.:.:|
Human   419 LRNITELRRI 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 49/159 (31%)
RSPH10B2XP_006715829.1 COG4642 <86..162 CDD:226989 7/29 (24%)
PLN03185 128..>318 CDD:215619 56/191 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.