| Sequence 1: | NP_726512.1 | Gene: | CG30429 / 246609 | FlyBaseID: | FBgn0050429 | Length: | 305 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_065629.1 | Gene: | Jph1 / 57339 | MGIID: | 1891495 | Length: | 660 | Species: | Mus musculus |
| Alignment Length: | 308 | Identity: | 56/308 - (18%) |
|---|---|---|---|
| Similarity: | 88/308 - (28%) | Gaps: | 156/308 - (50%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 24 FYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPEGQLIYEGDWV--MNKRQGVGSMLR 86
Fly 87 KRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQW---------------- 135
Fly 136 --------YNDGNI--------------------------------------------------- 141
Fly 142 ------------------------------------------------------YAGEWETDFRH 152
Fly 153 GLGVMFYANGNRYEGHFARGYKNGEG--VFYHMHTGQIQKGMWENDNL 198 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG30429 | NP_726512.1 | COG4642 | 59..194 | CDD:226989 | 44/267 (16%) |
| Jph1 | NP_065629.1 | PLN03185 | 4..>143 | CDD:215619 | 32/110 (29%) |
| MORN 1 | 14..36 | ||||
| MORN 2 | 38..59 | 2/6 (33%) | |||
| MORN 3 | 60..82 | 9/36 (25%) | |||
| PLN03185 | 106..>325 | CDD:215619 | 34/221 (15%) | ||
| MORN 4 | 106..128 | 8/21 (38%) | |||
| MORN 5 | 129..151 | 7/21 (33%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 228..247 | 0/18 (0%) | |||
| MORN 6 | 281..303 | 10/21 (48%) | |||
| MORN 7 | 304..326 | 9/24 (38%) | |||
| PTZ00449 | <424..>621 | CDD:185628 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 437..631 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG4642 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||