DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and JPH1

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001304759.1 Gene:JPH1 / 56704 HGNCID:14201 Length:661 Species:Homo sapiens


Alignment Length:308 Identity:57/308 - (18%)
Similarity:87/308 - (28%) Gaps:156/308 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPEGQLIYEGDWV--MNKRQGVGSMLR 86
            :.:|.|.:|.|||...|..|.||:               .:|:.:|.|:|.  ...|.||...|.
Human    52 YTWPSGNTYQGYWAQGKRHGLGVE---------------TKGKWMYRGEWSHGFKGRYGVRQSLC 101

  Fly    87 KRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQ----------------- 134
            ....     |.|.|.:.::.|.|.:.|.||..|.|:|....|||.|::                 
Human   102 TPAR-----YEGTWSNGLQDGYGVETYGDGGTYQGQWAGGMRHGYGVRQSVPYGMATVIRSPLRT 161

  Fly   135 -----------------------------------WYNDGNI----------------------- 141
                                               ::.|..:                       
Human   162 SLASLRSEQSNGSVLHDAAAAADSPAGTRGGFVLNFHADAELAGKKKGGLFRRGSLLGSMKLRKS 226

  Fly   142 ------------------------------------------------------YAGEWETDFRH 152
                                                                  |.|||:.|.|:
Human   227 ESKSSISSKRSSVRSDAAMSRISSSDANSTISFGDVDCDFCPVEDHVDATTTETYMGEWKNDKRN 291

  Fly   153 GLGVMFYANGNRYEGHFARGYKNGEG--VFYHMHTGQIQKGMWENDNL 198
            |.||...:||.:|||.:|...::|.|  ||   ..|..::|.::|:.|
Human   292 GFGVSERSNGMKYEGEWANNKRHGYGCTVF---PDGSKEEGKYKNNIL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 45/267 (17%)
JPH1NP_001304759.1 PLN03185 4..>143 CDD:215619 32/110 (29%)
MORN 1 14..36
MORN 2 38..59 2/6 (33%)
MORN 3 60..82 9/36 (25%)
PLN03185 106..>325 CDD:215619 35/221 (16%)
MORN 4 106..128 8/21 (38%)
MORN 5 129..151 7/21 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..247 0/18 (0%)
MORN 6 281..303 11/21 (52%)
MORN 7 304..326 9/24 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..631
TonB <434..>528 CDD:223880
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.