Sequence 1: | NP_726512.1 | Gene: | CG30429 / 246609 | FlyBaseID: | FBgn0050429 | Length: | 305 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001037813.1 | Gene: | jph1b / 556485 | ZFINID: | ZDB-GENE-060616-389 | Length: | 673 | Species: | Danio rerio |
Alignment Length: | 340 | Identity: | 61/340 - (17%) |
---|---|---|---|
Similarity: | 95/340 - (27%) | Gaps: | 170/340 - (50%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 FYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPEGQLIYEGDWV--MNKRQGVGSMLR 86
Fly 87 KRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQW---------------- 135
Fly 136 ----------------------------------------------------------------- 135
Fly 136 -------------------------------YNDGNI------------------YAGEWETDFR 151
Fly 152 HGLGVMFYANGNRYEGHFARGYKNGEGVFYHMHTGQIQKGMWEND--------------NLKTSV 202
Fly 203 VQD---EPKIRCNAV 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30429 | NP_726512.1 | COG4642 | 59..194 | CDD:226989 | 42/266 (16%) |
jph1b | NP_001037813.1 | MORN | 106..128 | CDD:280628 | 8/21 (38%) |
MORN | 305..327 | CDD:280628 | 6/22 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4642 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |