DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and rtp

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_649520.1 Gene:rtp / 40627 FlyBaseID:FBgn0087005 Length:198 Species:Drosophila melanogaster


Alignment Length:106 Identity:31/106 - (29%)
Similarity:53/106 - (50%) Gaps:25/106 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 GEGKQFYSDGCV------------YFGKW-IKNRRHGLGIQWYNDGNIYAGEWETDFRHGLGVMF 158
            |:|:..||.|.|            |.|:| .:.::||:|...:.||..|.|:::.....|:|.::
  Fly    40 GQGQSQYSAGAVKVGGWRYEDASRYIGEWNQRGQKHGIGHLQFADGTRYDGQFQEGLSQGVGCLW 104

  Fly   159 YANGNRYEGHFARGYKNGEGVFYHMHTGQIQKGMWENDNLK 199
            :|:|.:|||.|.:|:.:|.|:|            |..|.:|
  Fly   105 FADGAKYEGEFHQGWFHGNGIF------------WRADGMK 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 28/99 (28%)
rtpNP_649520.1 COG4642 54..>151 CDD:332236 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.