DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and Als2

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster


Alignment Length:333 Identity:73/333 - (21%)
Similarity:112/333 - (33%) Gaps:102/333 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CSSGRRATFY------YPGGGSYSGYWLCNKHQGWGVKKTAKRTCQY--------FYG------- 59
            |.:.|:...:      ||.|..|.|.......:|:| |.....|..|        |:|       
  Fly   744 CGTWRKGVLHGNCYLEYPDGSVYCGELQHGIIEGFG-KMVIPTTGLYVGNFKGGRFHGHGVYEMH 807

  Fly    60 -KKHPEGQLIYEGDWVMNKRQGVGSMLRKRGTEVQLIYSGRWYDDMKCGEGK-QFYSDGCVYFGK 122
             |..||.: :|||::......|.|.|...|     .||.|.:..:.:.|.|. :....|..|.|.
  Fly   808 CKDSPESE-VYEGNFCEGLFHGHGVMRNNR-----YIYVGEYQANARSGYGVIEDLVSGDKYMGM 866

  Fly   123 WIKNRRHGLGIQWYNDGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARGYKNGEGVFY------ 181
            :..|:|.|:|....|.|:.:.|.:..|...|.||..:.|...|||.......||.|.:|      
  Fly   867 FADNKRSGIGSCITNRGDYFEGSFSGDDLTGSGVAVFENDYYYEGELTLLGPNGRGEYYMPSGDA 931

  Fly   182 -----HMHTGQIQ--------------KGMWENDNLKTSVVQDEPKIRCNAVITSYPIPRNYLKY 227
                 .|.||:..              .|.|           |..:|:...::    :.|.:.||
  Fly   932 CGGSGAMGTGEFDDTCELIGNKMFGQLSGTW-----------DTVRIQAGELV----LNRRFPKY 981

  Fly   228 PNEIMRDLFQRHKDFSNKPHRRFNDRVSLAFIHHHRQYASCEERFASPTIVDLYPRAEFGCTCDC 292
            |:.:.|.:                       :.|:|::.|....|.|    ||     ..||...
  Fly   982 PSSLGRQV-----------------------VDHNRKWRSLFNNFES----DL-----ANCTAST 1014

  Fly   293 ENVARNET 300
            .:...|::
  Fly  1015 SSSGGNQS 1022

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 42/168 (25%)
Als2NP_649347.1 RCC1 258..304 CDD:278826
RCC1_2 292..321 CDD:290274
RCC1 308..361 CDD:278826
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.