DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and CG3306

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_648335.1 Gene:CG3306 / 39116 FlyBaseID:FBgn0036016 Length:288 Species:Drosophila melanogaster


Alignment Length:102 Identity:25/102 - (24%)
Similarity:47/102 - (46%) Gaps:23/102 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 TEVQLIYSGRWY----DDMKCGE-GKQFYSDGCVYFGKWIKNRRHG---------LGIQW---YN 137
            |:|.::.:|..|    |::...| |...|.||..|.|:::.||.||         ||:.:   ::
  Fly    12 TQVDILLTGSRYVGPSDELGMQEMGVYIYPDGTCYTGEFLNNRFHGKGTIQIPDSLGVTYQVTHH 76

  Fly   138 DGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARGYK 174
            :|.:.:.: :.:|...|.|.|     ..:.|:...:|
  Fly    77 NGRLVSID-QVNFNDSLPVDF-----EMKDHYTMSFK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 25/102 (25%)
CG3306NP_648335.1 COG4642 <36..90 CDD:226989 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.