DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and Rsph1

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001012176.1 Gene:Rsph1 / 361818 RGDID:1307712 Length:300 Species:Rattus norvegicus


Alignment Length:147 Identity:50/147 - (34%)
Similarity:72/147 - (48%) Gaps:15/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GKKHPEGQL------IYEGDWVMNKRQGVGSMLRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGC 117
            |::|..|:.      .|||::...||.|.|:...|.|..    |.|.:..:.|.|:|...|.||.
  Rat    28 GERHGHGKARLPNGDTYEGNYESGKRHGQGTYKFKNGAR----YVGDYVKNKKHGQGTFVYPDGS 88

  Fly   118 VYFGKWIKNRRHGLGIQWYNDGNIYAGEWETDFRHGLGVMFYA-NGNRYEGHFARGYKNGEGVFY 181
            .|.|:|..::|||.|:.:|.:.:.|.|||....|||.|..||| .|::|.|.:..|.:.|.....
  Rat    89 RYEGEWADDQRHGHGVYYYVNNDTYTGEWFNHQRHGQGTYFYAETGSKYVGTWVHGQQEGAAELI 153

  Fly   182 HM-HTGQIQKGMWENDN 197
            |: |..|   |.:.|.|
  Rat   154 HLNHRYQ---GKFINKN 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 48/142 (34%)
Rsph1NP_001012176.1 COG4642 37..172 CDD:226989 47/138 (34%)
MORN 42..63 CDD:197832 7/20 (35%)
MORN 67..89 CDD:280628 8/21 (38%)
MORN 88..109 CDD:197832 8/20 (40%)
MORN 111..131 CDD:197832 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.