DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and jp

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001188757.1 Gene:jp / 34274 FlyBaseID:FBgn0032129 Length:1054 Species:Drosophila melanogaster


Alignment Length:257 Identity:65/257 - (25%)
Similarity:90/257 - (35%) Gaps:92/257 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SSGRR-----ATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPEGQLIYEGDWVMN 76
            :.|||     ..|.:..||:|.|.|...|..|.||       |.   |.||   |..|.|.|   
  Fly    40 AGGRRGPINGGRFDFEDGGTYCGGWDEGKAHGHGV-------CT---GPKH---QGAYAGAW--- 88

  Fly    77 KRQGVGSMLRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGI-------- 133
                      ..|.||               .|...:..|..|.|:|...||||||:        
  Fly    89 ----------NYGFEV---------------SGSYIWPSGSHYEGQWQNGRRHGLGVEQIGRQIY 128

  Fly   134 --QWYNDGN--------------IYAGEWETDFRHGLGVMFYANGNRYEGHFARGYKNGEGV--- 179
              :|..||:              .|.|.|...::.|.|...||:|.:|:|.:..|.::|.|:   
  Fly   129 RGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYGIRTS 193

  Fly   180 ------------FYHMHTGQIQKGMWENDNLKTSVVQDEPKIRCNAVITS----YPIPRNYL 225
                        ..|.....::.|  ||.| ...:|:...:||...|:|:    .|:.||.|
  Fly   194 APFGLASHHRRKNLHASLSSLRSG--ENGN-AAKMVEKAEEIRGGFVLTAKSDKLPVRRNSL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 39/173 (23%)
jpNP_001188757.1 PLN03185 46..>192 CDD:215619 48/186 (26%)
PLN03185 333..>388 CDD:215619
MORN 357..379 CDD:308220
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.