DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and Jph3

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001100907.1 Gene:Jph3 / 307916 RGDID:1308416 Length:749 Species:Rattus norvegicus


Alignment Length:151 Identity:50/151 - (33%)
Similarity:64/151 - (42%) Gaps:19/151 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SSGRRATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKH----------PEGQLIYEG 71
            |||.|  |.:..||||.|.|...|..|.||....|...:|.....|          |.|. .|:|
  Rat     2 SSGGR--FNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGN-TYQG 63

  Fly    72 DWVMNKRQGVGSMLRKRGTEVQLIYSGRWYDDMKCGEG-KQFYSDGCVYFGKWIKNRRHGLGIQW 135
            .|...||.|:|  |..:|   :.:|.|.|....|...| ::...:|..|.|.|....:.|.|.:.
  Rat    64 TWAQGKRHGIG--LESKG---KWVYKGEWTHGFKGRYGVRECTGNGAKYEGTWSNGLQDGYGTET 123

  Fly   136 YNDGNIYAGEWETDFRHGLGV 156
            |:||..|.|:|....|.|.||
  Rat   124 YSDGGTYQGQWVGGMRQGYGV 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 33/109 (30%)
Jph3NP_001100907.1 MORN 15..35 CDD:280628 7/19 (37%)
MORN 107..129 CDD:280628 8/21 (38%)
MORN 311..333 CDD:280628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.