DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and Morn1

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_038965637.1 Gene:Morn1 / 298676 RGDID:1359433 Length:552 Species:Rattus norvegicus


Alignment Length:203 Identity:58/203 - (28%)
Similarity:81/203 - (39%) Gaps:44/203 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GWGVKKTAKRTCQYFYGKKHPEGQLIYEGDWVMNKRQGVGSMLRKRGTEVQLIYSGRWYDDMKCG 107
            |:||         |.|    |.....|||:|...|:.|.|.:|.|.|:    .|.|.:.:....|
  Rat    26 GYGV---------YVY----PNSFFRYEGEWKGGKKHGHGKLLFKDGS----YYEGEFVNGEITG 73

  Fly   108 EGKQFYS-DGCVYFGKWIKNRRHGLGIQWY-----------------------NDGNIYAGEWET 148
            ||.|.:: .|..|.|:::.....|.||..|                       .||.:|.|.:..
  Rat    74 EGYQHWAWSGNTYSGQFVLGEPQGHGIMKYKAGGHYEGELSQGLREGQGFLEDQDGQVYQGSFHD 138

  Fly   149 DFRHGLGVMFYANGNRYEGHFARGYKNGEGVFYHMHTGQIQKGMWENDNLK--TSVVQDEPKIRC 211
            :.|||.|.|.:.||::|||.:.|..:.|.||.: ...|...||.|.||...  .|:|.......|
  Rat   139 NKRHGRGQMVFKNGDKYEGDWVRDQRQGHGVLF-CADGSTYKGQWHNDVFSGLGSLVHCSGVTYC 202

  Fly   212 NAVITSYP 219
            ...|..:|
  Rat   203 GMFINGHP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 45/158 (28%)
Morn1XP_038965637.1 PLN03185 58..>208 CDD:215619 42/154 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.