Sequence 1: | NP_726512.1 | Gene: | CG30429 / 246609 | FlyBaseID: | FBgn0050429 | Length: | 305 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001100100.1 | Gene: | Jph1 / 297748 | RGDID: | 1308789 | Length: | 660 | Species: | Rattus norvegicus |
Alignment Length: | 308 | Identity: | 56/308 - (18%) |
---|---|---|---|
Similarity: | 88/308 - (28%) | Gaps: | 156/308 - (50%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 FYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPEGQLIYEGDWV--MNKRQGVGSMLR 86
Fly 87 KRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQW---------------- 135
Fly 136 --------YNDGNI--------------------------------------------------- 141
Fly 142 ------------------------------------------------------YAGEWETDFRH 152
Fly 153 GLGVMFYANGNRYEGHFARGYKNGEG--VFYHMHTGQIQKGMWENDNL 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30429 | NP_726512.1 | COG4642 | 59..194 | CDD:226989 | 44/267 (16%) |
Jph1 | NP_001100100.1 | PLN03185 | 4..>143 | CDD:215619 | 32/110 (29%) |
PLN03185 | 106..>325 | CDD:215619 | 34/221 (15%) | ||
PspC_subgroup_2 | <410..621 | CDD:411408 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4642 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |