DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and Jph2

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001033063.1 Gene:Jph2 / 296345 RGDID:1305196 Length:692 Species:Rattus norvegicus


Alignment Length:186 Identity:50/186 - (26%)
Similarity:66/186 - (35%) Gaps:67/186 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SSGRRATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPEGQLIYEGDWVMNKRQGV 81
            |.||   |.:..||:|.|.|...|..|.|:       |      ..|:||..|.|.|        
  Rat     2 SGGR---FDFDDGGAYCGGWEGGKAHGHGL-------C------TGPKGQGEYSGSW-------- 42

  Fly    82 GSMLRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQ----WY------ 136
                 ..|.||..:|:               :..|..:.|.|.:.:||||||:    |.      
  Rat    43 -----NFGFEVAGVYT---------------WPSGNTFEGYWSQGKRHGLGIETKGRWLYKGEWT 87

  Fly   137 -------------NDGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARGYKNGEGV 179
                         |.|..|.|.|....:.|.|...||:|..|:|.|..|.::|.||
  Rat    88 HGFKGRYGIRQSTNSGAKYEGTWNNGLQDGYGTETYADGGTYQGQFTNGMRHGYGV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 37/144 (26%)
Jph2NP_001033063.1 MORN 1. /evidence=ECO:0000255 14..36 9/34 (26%)
MORN 2. /evidence=ECO:0000255 38..59 8/48 (17%)
MORN 3. /evidence=ECO:0000255 60..79 8/18 (44%)
MORN 4. /evidence=ECO:0000255 82..104 1/21 (5%)
MORN 106..128 CDD:280628 8/21 (38%)
MORN 5. /evidence=ECO:0000255 106..128 8/21 (38%)
MORN 6. /evidence=ECO:0000255 129..151 7/15 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..190
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..273
MORN 7. /evidence=ECO:0000255 285..307
MORN 307..327 CDD:197832
MORN 8. /evidence=ECO:0000255 308..330
Bipartite nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q9ET78 345..359
Vinculin <413..>497 CDD:279395
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..661
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q9ET78 488..492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.