DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG30429 and Morn4

DIOPT Version :9

Sequence 1:	NP_726512.1	Gene:	CG30429 / 246609	FlyBaseID:	FBgn0050429	Length:	305	Species:	Drosophila melanogaster
Sequence 2:	NP_001020146.1	Gene:	Morn4 / 293950	RGDID:	1307336	Length:	146	Species:	Rattus norvegicus

Alignment Length:	138	Identity:	41/138 - (29%)
Similarity:	64/138 - (46%)	Gaps:	33/138 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   104 MKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQWYNDGNIYAGEWETDFRHGLGVMFYANGNRYEGH 168
            |...:|...||.|..|.|:|.:.||||.|...:.||..|.|.:|....:|.||:.:::|:||||.
  Rat     1 MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGE 65

  Fly   169 FARGYKNGEGVFY---------HMHTGQI-----------------QKGMWENDNLKTSVVQDEP 207
            |::|..||.|||.         ....|::                 .:|::||:.|..
  Rat    66 FSQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGLPRNEGLFENNKLLR------- 123

  Fly   208 KIRCNAVI 215
            :.:|:||:
  Rat   124 REKCSAVV 131

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG30429	NP_726512.1	COG4642	59..194	CDD:226989	35/115 (30%)
Morn4	NP_001020146.1	COG4642	5..106	CDD:226989	33/100 (33%)
		MORN 1	16..38		10/21 (48%)
		MORN 2	39..61		7/21 (33%)
		MORN 3	62..84		10/21 (48%)
		MORN 4	85..107		1/21 (5%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4642
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900