DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and Rsph10b

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_006248920.1 Gene:Rsph10b / 288478 RGDID:1311893 Length:906 Species:Rattus norvegicus


Alignment Length:213 Identity:63/213 - (29%)
Similarity:98/213 - (46%) Gaps:32/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FCPNKPVCSSGRRATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYF----YGKKHPEGQLI- 68
            |..|.|:    ....:.:|.|.:|.|..:.....|:|:.|...:...|.    :||:|.:|.:. 
  Rat   166 FVKNIPM----NHGVYTWPDGSTYEGEVVNGMRNGFGMFKCGTQPVSYIGHWCHGKRHGKGSIYY 226

  Fly    69 -------YEGDWVMNKRQGVGSMLRKRGTEVQLIYSGRWYDDMKCGEGK-QFYSDGCVYFGKWIK 125
                   ||||||.|.::|.|....|.|.    ||.|:|.::|:.|||: ::.:....|.|.|.|
  Rat   227 NQEGTSWYEGDWVYNIKKGWGIRCYKSGN----IYEGQWENNMRHGEGRMRWLTTNEEYTGHWEK 287

  Fly   126 NRRHGLGIQ-W---------YNDGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARGYKNGEGVF 180
            ..::|.|.. |         |...|.|.|.:...||||.|..:||:|..|||.:....|.|.|..
  Rat   288 GIQNGFGTHTWFLKRIPNSQYPLRNEYIGAFVNGFRHGQGKFYYASGAMYEGEWVSNKKQGRGRI 352

  Fly   181 YHMHTGQIQKGMWENDNL 198
             ....|::.:|::.||::
  Rat   353 -TFKNGRVYEGLFSNDHI 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 50/153 (33%)
Rsph10bXP_006248920.1 PLN03185 86..>200 CDD:215619 9/37 (24%)
PLN03185 158..>421 CDD:215619 63/213 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.