DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and MORN3

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001350614.1 Gene:MORN3 / 283385 HGNCID:29807 Length:240 Species:Homo sapiens


Alignment Length:254 Identity:80/254 - (31%)
Similarity:120/254 - (47%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CPNK----------PVCSSGRRATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPE 64
            ||.|          ....:|.|:..|...|..|.|.|..|...|.|.:...|:..          
Human     6 CPKKSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWKDNVKHGKGTQVWKKKGA---------- 60

  Fly    65 GQLIYEGDWVMNKRQGVG--SMLRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNR 127
               ||||||...||.|.|  |:..::..:.:.:|||.|..|.|.|.|.||:.....|.|.|..::
Human    61 ---IYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQ 122

  Fly   128 RHGLGIQWYNDGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARGYKNGEGVFYHMHTGQIQKGM 192
            |.|.|..:|::|:||.|:||.|..:|.|::...|||||||.:.||.|||.|.|:|:..||:.:|.
Human   123 RSGWGRMYYSNGDIYEGQWENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGF 187

  Fly   193 WENDNLKTSVVQD-------EPKIRCNAVITSYPIPRNYLKYPNEIMRD---LFQRHKD 241
            |.::..|...:.|       ||        |.:|||...:..|:.::.:   :|::.::
Human   188 WVDNMAKCGTMIDFGRDEAPEP--------TQFPIPEVKILDPDGVLAEALAMFRKTEE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 55/136 (40%)
MORN3NP_001350614.1 COG4642 34..>188 CDD:332236 63/166 (38%)
MORN 1 38..60 7/21 (33%)
MORN 2 62..84 10/21 (48%)
MORN 3 91..113 10/21 (48%)
MORN 4 114..136 8/21 (38%)
MORN 5 137..159 9/21 (43%)
MORN 6 160..182 11/21 (52%)
MORN 7 184..205 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151929
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H42069
Inparanoid 1 1.050 129 1.000 Inparanoid score I4666
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56904
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41654
orthoMCL 1 0.900 - - OOG6_105410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4901
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.700

Return to query results.
Submit another query.