DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and jph-1

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_492193.2 Gene:jph-1 / 266843 WormBaseID:WBGene00002179 Length:747 Species:Caenorhabditis elegans


Alignment Length:297 Identity:71/297 - (23%)
Similarity:112/297 - (37%) Gaps:91/297 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SSGRRATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPEGQLIYEGDWVMNKRQGV 81
            :.||   |.:..||:|.|.|...|..|.||       |      ..|:.:..|.|.|        
 Worm     2 NGGR---FDFDDGGTYVGGWEEGKAHGHGV-------C------TGPQAKGEYAGAW-------- 42

  Fly    82 GSMLRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQ----WYNDGNIY 142
                 ..|.||..:|:               :..|..|.|:|...:||||||:    |     :|
 Worm    43 -----HYGFEVSGVYT---------------WPSGNTYQGQWQNGKRHGLGIEQRGRW-----LY 82

  Fly   143 AGEWETDFRHGLGVMFYANGN-RYEGHFARGYKNGEGVFYHMHTGQIQ----KGMWENDNLKTSV 202
            .|||...::...||...||.. ||:|.::.|:.:|.|...::.:|..|    :||.....::.|.
 Worm    83 KGEWTQGYKGRYGVRQSANSQARYQGTWSAGFHDGYGTEIYVDSGSYQGQWLRGMRHGYGIRKST 147

  Fly   203 VQDE-----PKIRCNAVITSYPIPRNYLKYPNEIMRDLFQRHKD------------FSNKPHRRF 250
            ..::     .|.:.:|.:||....|  ::..|....   .|||:            .|:.|.||.
 Worm   148 TYEKAAKFRSKSQTHASLTSLRSGR--VEEENAAEE---HRHKEGLSGRGGFVLRANSSAPQRRR 207

  Fly   251 ND---------RVSLAFIHHHRQYAS--CEERFASPT 276
            ..         |..|:.:...:|:::  ..:|.||.|
 Worm   208 RSLSERSLAVKRTLLSGLRIKKQHSTGDIHQRVASMT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 37/143 (26%)
jph-1NP_492193.2 MORN 58..>74 CDD:197832 7/15 (47%)
MORN 283..303 CDD:280628
MORN 306..328 CDD:280628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.