DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and ALS2CL

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001177636.1 Gene:ALS2CL / 259173 HGNCID:20605 Length:953 Species:Homo sapiens


Alignment Length:346 Identity:71/346 - (20%)
Similarity:120/346 - (34%) Gaps:78/346 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CLERFFCPNKPVCSS--------GR---RATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYF 57
            |.|..|.....:|.:        ||   :.|..:|.|.::.|.:......|:|::...:.:...|
Human   342 CAEYTFQAEGRLCQATYEGEWCRGRPHGKGTLKWPDGRNHVGNFCQGLEHGFGIRLLPQASEDKF 406

  Fly    58 --YGKKHPEGQL------------IYEGDWVMNKRQGVGSMLRKRGTEVQLIYSGRWYDDMKCGE 108
              |.....||.:            :|:|.:....|.|.|.:...........|:|.|....:.|.
Human   407 DCYKCHWREGSMCGYGICEYSTDEVYKGYFQEGLRHGFGVLESGPQAPQPFRYTGHWERGQRSGY 471

  Fly   109 GKQFYSD-GCVYFGKWIKNRRHGLGIQWYNDGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARG 172
            |.:...| |..|.|.|...:|||.|:.....|..|.|.::.|...|.|::...:.:.|||.|.|.
Human   472 GIEEDGDRGERYIGMWQAGQRHGPGVMVTQAGVCYQGTFQADKTVGPGILLSEDDSLYEGTFTRD 536

  Fly   173 ----------YKNG---EGVFYHMHTGQIQKGMWENDNLKTSVVQDEPKIRCNAV--ITSYPIPR 222
                      :.||   ||.|    .....:|:.....|.|:.:..:|...|...  :.::|:..
Human   537 LTLMGKGKVTFPNGFTLEGSF----GSGAGRGLHTQGVLDTAALPPDPSSTCKRQLGVGAFPVES 597

  Fly   223 NYLKYPNEIMRDLFQRHKDF-------------------SNKPHRRFNDRVSLAFIHHHRQYASC 268
            .:        :.::...:||                   |::..||..|.:|....|......|.
Human   598 RW--------QGVYSPFRDFVCAGCPRDLQEALLGFDVQSSRELRRSQDYLSCERTHPEDSVGSM 654

  Fly   269 EE------RFASPTIVDLYPR 283
            |:      :...|..:.||.|
Human   655 EDILEELLQHREPKALQLYLR 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 38/160 (24%)
ALS2CLNP_001177636.1 PH-like 223..321 CDD:302622
COG4642 358..519 CDD:226989 36/160 (23%)
MORN 1 358..380 5/21 (24%)
MORN 358..378 CDD:280628 4/19 (21%)
MORN 2 381..403 3/21 (14%)
MORN 3 409..431 3/21 (14%)
MORN 4 432..452 5/19 (26%)
MORN 5 459..479 5/19 (26%)
COG4642 480..>569 CDD:226989 25/92 (27%)
MORN 6 483..505 8/21 (38%)
MORN 7 506..528 5/21 (24%)
MORN 8 529..552 7/22 (32%)
VPS9 834..938 CDD:280383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.