DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and MORN5

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_940871.2 Gene:MORN5 / 254956 HGNCID:17841 Length:161 Species:Homo sapiens


Alignment Length:164 Identity:38/164 - (23%)
Similarity:63/164 - (38%) Gaps:30/164 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 YSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQWYNDGNIYAGEWETDFRHGL---GVM 157
            |.|.:.|....|:.|.......:|.|:......||.|..::..|:.|...||    :||   |..
Human     8 YIGEYVDGRMEGKAKYILPTETIYVGEMKDGMFHGEGTLYFPSGSQYDAIWE----NGLAIKGTY 68

  Fly   158 FYANGNRYE---GHFARGYKNGEGVFY-HMHTGQIQKGMWENDNLKTSVVQDEPKIRCNAVITSY 218
            .:::|..|:   .|:..||   :..|| .:..|....||.:..|:      |.|:          
Human    69 TFSDGLHYDEKNWHYCDGY---DRRFYTEILNGLKPAGMAQLTNM------DPPR---------- 114

  Fly   219 PIPRNYLKYPNEIMRDLFQRHKDFSNKPHRRFND 252
            .||:.|....:.....:.:..||:.|:..|..:|
Human   115 KIPKGYYDCGDGFYNPVTRVVKDYRNRFLRNADD 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 27/104 (26%)
MORN5NP_940871.2 COG4642 5..>76 CDD:332236 18/71 (25%)
MORN 1 8..30 5/21 (24%)
MORN 2 31..53 6/21 (29%)
MORN 3 54..75 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.