DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and Als2cl

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001139531.1 Gene:Als2cl / 235633 MGIID:2447532 Length:952 Species:Mus musculus


Alignment Length:194 Identity:46/194 - (23%)
Similarity:65/194 - (33%) Gaps:58/194 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KTAKRTCQYFYGKKH-------------PEGQLIYEGDWVMNKRQGVGSMLRKRGTEVQLIYSGR 99
            |..:..||...|||.             ||.:.             |....|:.|...|..|.|.
Mouse   310 KVTQAVCQALCGKKDFPVLGSGRETSVPPECRC-------------VAYTFRREGRLCQATYDGE 361

  Fly   100 WYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGI----------------QW------------Y 136
            |......|:|...:.||..:.|.:.:...||.||                .|            |
Mouse   362 WCRAKPHGKGTLKWPDGRNHVGTFYQGLEHGFGICLVPQASEDKFDCYKCHWREGRMCEYGICEY 426

  Fly   137 NDGNIYAGEWETDFRHGLGVMFYA----NGNRYEGHFARGYKNGEGVFYHMHTGQIQKGMWEND 196
            ....:|.|.::...|||.|::..|    ...||.||:.||.::|.|:......|:...|||:.|
Mouse   427 GTDEVYKGYFQAGLRHGFGILESAPQAPQPFRYTGHWERGQRSGYGIEEDRDRGERYIGMWQAD 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 41/179 (23%)
Als2clNP_001139531.1 PH-like 223..321 CDD:388408 3/10 (30%)
PLN03185 357..>550 CDD:215619 34/134 (25%)
MORN 1 358..380 7/21 (33%)
MORN 2 381..403 5/21 (24%)
MORN 3 409..431 2/21 (10%)
MORN 4 432..454 7/21 (33%)
MORN 5 459..481 7/21 (33%)
MORN 6 483..505 4/8 (50%)
MORN 7 506..528
MORN 8 529..552
VPS9 835..937 CDD:388595
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.