DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and Morn4

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_932776.1 Gene:Morn4 / 226123 MGIID:2449568 Length:146 Species:Mus musculus


Alignment Length:141 Identity:48/141 - (34%)
Similarity:67/141 - (47%) Gaps:25/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 MKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQWYNDGNIYAGEWETDFRHGLGVMFYANGNRYEGH 168
            |...:|...||.|..|.|:|.:.||||.|...:.||..|.|.:|....:|.||:.:::|:||||.
Mouse     1 MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLVFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGE 65

  Fly   169 FARGYKNGEGVF--YHMHT--GQIQKGMWENDNLKTSVVQDEPKIRCNAVITSYPIPRNYLKYPN 229
            |::|..||.|||  |...|  |:.:.|..:...|.|.     |.       .|:.||||      
Mouse    66 FSQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTF-----PD-------GSHGIPRN------ 112

  Fly   230 EIMRDLFQRHK 240
               ..||:.:|
Mouse   113 ---EGLFENNK 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 37/93 (40%)
Morn4NP_932776.1 PLN03185 6..>143 CDD:215619 47/136 (35%)
MORN 1 16..38 10/21 (48%)
MORN 2 39..61 7/21 (33%)
MORN 3 62..84 11/21 (52%)
MORN 4 85..107 5/33 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.