DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and Rsph1

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_079566.1 Gene:Rsph1 / 22092 MGIID:1194909 Length:301 Species:Mus musculus


Alignment Length:147 Identity:49/147 - (33%)
Similarity:71/147 - (48%) Gaps:15/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GKKHPEGQL------IYEGDWVMNKRQGVGSMLRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGC 117
            |::|..|:.      .|||.:...||.|.|:...|.|..    |:|.:..:.|.|:|...|.||.
Mouse    28 GERHGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNGAR----YTGDYVKNKKHGQGTFIYPDGS 88

  Fly   118 VYFGKWIKNRRHGLGIQWYNDGNIYAGEWETDFRHGLGVMFYA-NGNRYEGHFARGYKNGEGVFY 181
            .|.|:|..::|||.|:.:|.:.:.|.|||....|||.|...|| .|::|.|.:..|.:.|.....
Mouse    89 RYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWVHGQQEGAAELI 153

  Fly   182 HM-HTGQIQKGMWENDN 197
            |: |..|   |.:.|.|
Mouse   154 HLNHRYQ---GKFMNKN 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 47/142 (33%)
Rsph1NP_079566.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 3/12 (25%)
MORN 1 20..43 3/14 (21%)
COG4642 37..172 CDD:226989 46/138 (33%)
MORN 42..63 CDD:197832 7/20 (35%)
MORN 2 44..66 9/21 (43%)
MORN 67..89 CDD:280628 8/21 (38%)
MORN 3 67..89 8/21 (38%)
MORN 88..109 CDD:197832 8/20 (40%)
MORN 4 90..112 8/21 (38%)
MORN 111..131 CDD:197832 8/19 (42%)
MORN 5 113..135 10/21 (48%)
MORN 6 159..181 4/12 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.