DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and Pms2

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_036020772.1 Gene:Pms2 / 18861 MGIID:104288 Length:875 Species:Mus musculus


Alignment Length:213 Identity:65/213 - (30%)
Similarity:98/213 - (46%) Gaps:32/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FCPNKPVCSSGRRATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYF----YGKKHPEGQLI- 68
            |..|.|:    ....:.:|.|.:|.|........|:|:.|...:...|.    :||:|.:|.:. 
Mouse   136 FVKNIPM----NHGVYTWPDGSTYEGEVTNGMRNGFGMFKCGTQPVSYIGHWCHGKRHGKGSIYY 196

  Fly    69 -------YEGDWVMNKRQGVGSMLRKRGTEVQLIYSGRWYDDMKCGEGK-QFYSDGCVYFGKWIK 125
                   ||||||.|.::|.|....|.|.    ||.|:|.::|:.|||: ::.:....|.|.|.|
Mouse   197 NQEGTSWYEGDWVYNIKKGWGIRCYKSGN----IYEGQWENNMRHGEGRMRWLTTNEEYTGHWEK 257

  Fly   126 NRRHGLGIQ-W---------YNDGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARGYKNGEGVF 180
            ..::|.|.. |         |...|.|.||:...||||.|..:||:|..|||.:|...|.|.|..
Mouse   258 GIQNGFGTHTWFLKRIPNSQYPLRNEYIGEFVNGFRHGQGKFYYASGAMYEGEWASNKKQGRGRM 322

  Fly   181 YHMHTGQIQKGMWENDNL 198
             ....|.:.:|::.||::
Mouse   323 -TFKNGHVYEGLFSNDHI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 52/153 (34%)
Pms2XP_036020772.1 PLN03185 106..>405 CDD:215619 65/213 (31%)
vATP-synt_E 782..>829 CDD:419987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.