DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and MORN4

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_011537552.1 Gene:MORN4 / 118812 HGNCID:24001 Length:204 Species:Homo sapiens


Alignment Length:118 Identity:41/118 - (34%)
Similarity:56/118 - (47%) Gaps:25/118 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RRHGLGIQWYNDGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARGYKNGEGVF--YHMHT--GQ 187
            ||||.|...:.||..|.|.:|....:|.||:.:::|:||||.||:|..||.|||  |...|  |:
Human    82 RRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGKFNGVGVFIRYDNMTFEGE 146

  Fly   188 IQKGMWENDNLKTSVVQDEPKIRCNAVITSYPIPRNYLKYPNEIMRDLFQRHK 240
            .:.|..:...|.|.     |.       .|:.||||         ..||:.:|
Human   147 FKNGRVDGFGLLTF-----PD-------GSHGIPRN---------EGLFENNK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 30/70 (43%)
MORN4XP_011537552.1 COG4642 <81..179 CDD:226989 41/118 (35%)
MORN 97..119 CDD:280628 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.